KEGG   Actinomyces sp. VUL4_3: BK816_02265Help
Entry
BK816_02265       CDS       T04541                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
avu  Actinomyces sp. VUL4_3
Pathway
avu00511  Other glycan degradation
avu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:avu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BK816_02265
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BK816_02265
Enzymes [BR:avu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BK816_02265
Bacterial toxins [BR:avu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BK816_02265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 SLH Spc7 Reo_sigmaC BNR Golgin_A5 IncA DUF1664 CALCOCO1 AAA_13 Fez1 ATG16 DUF3584 TPR_MLP1_2 HOOK DUF1090 HMMR_N ADIP IFT57 GAS
Motif
Other DBs
NCBI-ProteinID: AOZ72268
UniProt: A0A1D9MJ81
LinkDB All DBs
Position
581386..585564
Genome map
AA seq 1392 aa AA seqDB search
MTQPKHIRRLVPTVALATGALLFGAMPLPSVPTAMAAGEKITFTFERTDNHGSTVHVGDR
LTFKIKYRNNTGGNLTPFPKTSNINDFDVTRFPDRNCRYFNLGPGVTKECGYGFHIVNRE
DMRNGSFTPTSSWNITHDRAGNDVIETGISVVGEPIAVDPNVPADNAQTPREYAMGAPVE
LARENYGGFNCHRIPALTKTPINGWLLAAWDGRPNDCQDAPQPNSIVYRISKDGGKSWTS
LKVALEGKENPVAEKYGYSDPSFVVDRETNKIFMFTVKSFDRKFQQGLPGVDPNNRGVMH
ASVVESTDDGQTWTNQRLITASTLKDESTWISRFATSGEGIQLKYGPHAGRLIQQYTTAF
PGAVWKAHSVYSDDHGVTWQTGEPTEQGADENKVVELSDGRLMVNSRTGSHHGPGGHHRM
YAYSTDQGETWGPWKTAWDLIDPVNNASLIRAFPDAPKNSMRAKILLFSNAKNGAQWQRN
NGYVRVSYDDGKNWNEGRQFKDGAMQYSTLTPLGEGKYGLLYEGNSKTINYMTIDNNWLH
LEDPGPDAMDPKPELETAKAENQRLTAELAEKTEKVAELTREKEQLESAKSALETERDQL
TQDKSRLEGEKATLEREKGELETAKRELESQKSALEEQKTQLTSEKEKLENKKSELEQKV
AELEANGQASAAELQRVKGELADVKEKLGTKTNELETANTELAETKAKLAKKEEALTGKT
GELENTNAELTKTKQTLGEKEAELATTKQQLANSQSELQKKTAEVDQTKQALANSNEKLA
KSQEKLAAKEGELASKKAEYDRNLQELTNQTAKANQKVKSLEAQVADLQEQVKSFENGKS
TPELEKAKKELAKATKELQAEQEKSAKLTNDLAVALDKVTKVESKAKENIGQLEKEVAGL
NDQVKKLSADKKASASALKAAKDKLAKAQANLATEKANVATLQEQLGAATTELAQSRQTA
GKKIATLEKKVENLEEAVKKAEAKGGANAPEVKEAKAKLADAQKELAGEKTKNAKLSDDL
NQALDKVAKVEREAQAEVSKLTNKVNQLEDNVAKLKADKNASAAQIKAAQEALSSAKQEL
NTERVKASGLRTELAKTLTKVSQLEKQSATKVQNLENKVSKINQELAKAKAEGKAGEAKV
AKLEQQLTTAQTDLKREKQTNGTLKSKVNQLDKQLRGTPRPAETVQQLLDKIGLRKAKAP
KAKKAPFKDVPLTNPFVNEIAWAATGEQKVTTGWPDGTFRPGLPVDRQTMAAFLYRMAGS
PKVKVNKVFKDVPVNHQFAKAISWMSQTGITTGWADGTFRPDQPIERHAMAAFMNRACVK
TNLCSPALKNLKVDPLLPKFKDMGEGKLFDREVQWMQQAGITTGWADGTFRPENSVTREA
MAAFLYRMKFNH
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaccaaaacatattcgtcgtctagtcccgacggtagcgttggcgaccggagca
ttgttatttggagcaatgcctttgccgtcggtaccaaccgcgatggcggcaggtgaaaag
atcacctttaccttcgagcgaactgataatcatggttccacagtgcacgttggggatcgc
ctgacctttaaaattaagtaccgcaataatacaggcgggaacctgacacctttcccaaag
acttcaaatattaacgattttgatgtcacgcgtttcccagatcgcaactgccgctatttt
aatcttggcccaggtgtcacaaaagaatgtggctatggtttccacattgtgaaccgagaa
gatatgcgcaacggaagttttactcctacttcttcttggaatattactcatgaccgtgca
ggtaacgatgtaatcgaaactggcatttctgtagtcggagaaccaattgccgttgatcca
aatgtgcccgcagataatgcacaaactccgcgagaatatgccatgggtgcaccagttgaa
ctggctcgtgagaattacggtggttttaattgtcaccgtattcccgcgttgactaagacc
ccgatcaacggatggctattggctgcttgggatggccgtcccaatgattgccaggatgcg
ccacagccgaacagcattgtctatcgtatttctaaagacggcggcaaatcttggacttct
cttaaggtagcgttggaaggcaaagaaaatccagtagctgaaaaatacggctattctgat
ccttcttttgtcgttgaccgcgaaaccaacaagattttcatgtttaccgtgaagtctttt
gaccgaaagttccaacaaggtcttcctggggttgacccaaacaaccgtggggtgatgcat
gcctcggtagtggaatctactgatgacggtcaaacttggacaaaccagcgtctgattaca
gctagcacgctgaaagacgaaagtacttggatttcccgtttcgcaacttccggcgaaggt
atccaactaaaatatggtcctcacgcagggcgattaattcagcagtacaccactgctttc
cctggagcggtctggaaagctcactcagtctattcggatgaccatggggtaacttggcaa
actggtgagccaacagaacaaggcgcggacgaaaataaagttgttgaactttcagacggg
cgtctgatggttaactcgcgcactggttcacatcatggcccgggcggacatcaccgtatg
tacgcttactctacagatcaaggtgaaacttggggaccatggaagaccgcctgggatttg
attgatcctgtcaacaacgcttctttgatccgtgctttccctgatgctccaaagaattca
atgcgtgcaaagattcttcttttctcaaatgcgaaaaacggtgctcagtggcaacgcaac
aatggttatgttcgtgtctcttacgatgatggtaagaactggaacgagggtcgtcagttt
aaagatggcgccatgcagtactcgaccttaaccccgcttggggaagggaagtatggtctg
ctttatgaaggtaactcgaagaccatcaattacatgaccattgacaacaactggctgcac
ctagaagatccgggcccagacgcgatggacccgaaacctgagctggagacggcgaaagcc
gaaaatcaacgcttgactgcagaactagctgaaaagactgaaaaggttgctgaactaact
cgtgagaaggaacagctagaatcagctaagtccgcactcgaaactgaacgtgaccagcta
acgcaagataagtctcgtttagaaggcgaaaaggccactcttgagcgcgagaagggcgag
ctcgaaactgcaaagcgtgagctagagagtcagaagtctgcgttagaggagcaaaagacc
cagctaactagcgaaaaagaaaagctggaaaataaaaagtctgaacttgagcagaaggtt
gctgaactggaagcaaatggtcaggcttcagctgccgaactacaaagggtaaagggcgaa
ctggctgatgttaaggaaaaacttggcacaaagaccaatgaactcgaaactgccaacact
gagctagctgagactaaagctaagctagcaaagaaggaggaagccctcaccggtaagact
ggcgagttggagaatactaacgctgagctgacaaagacgaagcaaaccttgggggagaaa
gaagcagaacttgctaccaccaagcagcagctagctaacagccagtctgaacttcaaaag
aagactgccgaggtcgatcagacgaaacaggcgctcgcgaatagcaatgagaaactggcg
aagagtcaggagaagctcgctgcaaaagaaggcgaacttgctagcaagaaggccgagtac
gatcgtaacttgcaggaactgaccaaccagaccgcgaaggcaaaccagaaggtaaagagt
ctggaagctcaggtggccgatttgcaagaacaggtcaaatcttttgaaaatggcaagtcc
actccagagcttgaaaaagccaagaaggaattggccaaagctaccaaggaattgcaggcg
gagcaagaaaagtcagctaagttgaccaacgatctagctgtcgcacttgataaagtcacc
aaggttgaatcaaaggctaaggaaaatattggtcaactcgaaaaggaagtggcaggtcta
aacgaccaagtcaagaagctaagcgccgataagaaggctagtgcttctgcgcttaaggct
gccaaggacaagctagctaaggcgcaagctaaccttgcaaccgaaaaggcaaacgttgcc
accctacaagaacagttaggtgctgccaccaccgagttagctcagagtcgtcaaactgct
gggaagaagatcgctaccctcgaaaagaaggttgagaatctcgaagaagcagtgaagaaa
gctgaagctaagggtggagcgaatgctccagaggttaaggaagctaaagccaagctagct
gacgcgcagaaagagctagccggtgaaaagactaagaatgccaagctgtcggatgacctc
aatcaagccctagataaggtggctaaggttgagcgcgaggcgcaagctgaagtttcaaag
cttaccaacaaggtaaatcagctagaagacaatgtagctaagctcaaagccgataagaac
gcctcggcagcccaaattaaggctgcgcaagaagcgctttcttcggctaaacaggaactc
aataccgaacgggttaaagcctctggtttgcgcaccgaactagccaagactcttaccaaa
gtgtcgcagctagaaaagcagtcagctactaaggttcagaatcttgaaaacaaggtttcc
aagattaatcaagagctagctaaggcgaaggctgaaggtaaagctggagaagcgaaggtt
gctaagctagaacagcaactaaccactgctcaaaccgatcttaagcgggaaaagcagact
aacggcactttgaagagcaaggtcaaccagctcgacaagcagttgcgtggcaccccgcgt
ccagctgaaactgtccagcaattgctcgataagatcggcttgcgcaaggcgaaagcacca
aaggcaaagaaggctccatttaaggatgtgcctttgactaacccatttgtcaatgaaatc
gcttgggccgctactggtgagcagaaggtgaccaccggttggccagacggcaccttccgc
ccaggtctcccagttgaccgtcagaccatggcagcattcttgtaccgtatggctggttct
cccaaggttaaggtcaacaaagtattcaaggacgtgcccgtgaatcaccagttcgccaag
gcaatttcatggatgtctcagactggtatcaccactggttgggctgatggtactttccgt
ccagatcagccgattgagcgtcatgcgatggcggcctttatgaatcgagcttgtgtgaag
actaatttgtgttcaccggctctaaagaaccttaaggttgatccgttgttgcctaagttc
aaggatatgggtgagggtaagttgttcgatcgggaagtgcagtggatgcagcaggctggt
attactaccggttgggctgatggtactttccgtccagaaaacagcgtgacccgtgaagct
atggcagcgttcttgtaccgcatgaagtttaatcactga

DBGET integrated database retrieval system