KEGG   Actinomyces tangfeifanii: BK816_05340Help
Entry
BK816_05340       CDS       T04541                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
avu  Actinomyces tangfeifanii
Pathway
avu00020  Citrate cycle (TCA cycle)
avu00380  Tryptophan metabolism
avu01100  Metabolic pathways
avu01110  Biosynthesis of secondary metabolites
avu01120  Microbial metabolism in diverse environments
avu01130  Biosynthesis of antibiotics
avu01200  Carbon metabolism
Module
avu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:avu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BK816_05340
  09105 Amino acid metabolism
   00310 Lysine degradation
    BK816_05340
   00380 Tryptophan metabolism
    BK816_05340
Enzymes [BR:avu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BK816_05340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AOZ72788
UniProt: A0A1D9MKN3
LinkDB All DBs
Position
1293122..1294873
Genome map
AA seq 583 aa AA seqDB search
MSTSVKMPALGESVTEGTVTTWLKSVGDAVTADEPLVEVATDKVDSEVPAPASGVLLKIL
VEEDETVEVGTEIAIIGDEGEAPAEEAPAKEEAPAKEEKAEAAPAKAEASASADQGETTD
VLMPALGESVTEGTVSSWLKAVGDKVEADEPLVEVATDKVDSEVPSPASGYLVEIVVPED
ETVEVGTVIAKIGSNEPAKGEPEPKPEPAPKAERSADEVPGSQIPSTVKDGEDGDKVVEW
TYPSAPSAPSAPAAPAAASADEAVTSRQSSGSGYVTPIVRKLAAEKGVDLSQLQGTGVGG
RIRKQDVLDAAVKAQAPAAPAAAPAAPAAPAAAAKPAAKLEPSPLRGKTEKMTPLRKTIA
KRMVDSLQTAAQLTTVVEVDVTKVAALRARYKNEFLEKKGTKLTFLPFFVKAATEALVAH
PKINATVNDDHTVTYHDAEHIGIAVDTPKGLFVPVVRDAGGKDLAGLADSINDLAARTRD
GKVEPKELSGSTFTITNTGSGGALFDTPVINMPETAILGLGTIVKRPMVVKDAEGNEAIA
IRSMVYLALSYDHRLVDGADAARYLMDVKRRLEAGDFTADLGL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtccacctctgtaaagatgccggcgcttggtgaatccgtcaccgagggcaccgttact
acctggctaaagtctgtgggtgacgcggttaccgccgatgaacccttagtcgaagttgca
accgacaaggttgattctgaagttccagccccagcttcgggcgtacttctaaagattttg
gtcgaagaagatgaaaccgttgaggttggtaccgaaatcgccatcattggcgacgagggc
gaagccccggctgaagaagccccagccaaggaagaagctccagctaaggaagaaaaggct
gaagcagctccagctaaggccgaagcttccgcaagcgcagaccagggtgaaaccactgac
gtcttgatgccagcactaggcgaatctgttaccgaaggtacagtctctagctggttgaag
gctgttggcgacaaggtcgaagcagatgaacctttggtagaagttgctaccgataaggtc
gactctgaagttccttccccagcttctggctacctcgttgaaattgtggttcccgaagat
gaaaccgttgaggttggtaccgtcatcgctaagattggtagcaacgaaccagcaaagggt
gaaccagaaccaaagccagaaccagctcctaaggctgagcgctcggctgacgaagttcct
ggctcacagattccatcgaccgttaaggacggcgaagatggcgacaaggtagtcgagtgg
acttatccatctgctccttctgccccatcggcccctgctgctccagccgctgctagtgca
gacgaggcagttacctcccgtcagtcctccggctctggctacgtaaccccaatcgtccgc
aaacttgccgcagaaaagggcgttgatctttcccagctacagggtaccggcgttggtggc
cgtatccgcaagcaggatgtcctagatgccgctgttaaggctcaggccccagctgctcca
gccgctgctccagccgctccagcagctcctgctgccgctgctaaaccagctgctaagctt
gagccttcgccgctacgtggcaagactgaaaagatgaccccgctacgcaagaccattgct
aagcgtatggttgattctttgcagaccgcagcacagctaaccaccgtcgtggaagttgac
gtcaccaaggtggctgctctccgcgcccgttacaagaacgaattccttgagaagaagggc
actaagcttaccttcttgccattcttcgttaaggctgctaccgaggcattggtcgctcac
ccgaagatcaacgccacggtaaatgacgaccacaccgttacctaccacgatgctgaacac
attggtattgcggttgatactcctaagggtctgttcgtaccagtcgttcgtgatgccggc
ggtaaggatctagctggtttggcagattcgatcaacgatctcgctgcacgcacccgtgac
ggcaaggtagagccgaaggaactctccggttcaacctttaccattaccaacactggttct
ggcggcgccttgtttgatactccagttatcaatatgccggaaaccgccatcttgggtcta
ggcaccattgtcaagcgtccaatggtagtcaaggatgctgaaggtaacgaagcaatcgct
attcgttccatggtttacttggccctctcctacgaccaccgtttggttgacggcgcagat
gctgcccgttacctcatggatgttaagcgtcgtttggaagctggcgacttcactgccgat
cttggcttgtga

DBGET integrated database retrieval system