KEGG   Anabaena sp. wa102: AA650_09780Help
Entry
AA650_09780       CDS       T04059                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
awa  Anabaena sp. wa102
Pathway
awa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
awa01100  Metabolic pathways
awa01110  Biosynthesis of secondary metabolites
awa01130  Biosynthesis of antibiotics
awa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:awa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AA650_09780
Enzymes [BR:awa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     AA650_09780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT ACT_4 ACT_5
Motif
Other DBs
NCBI-ProteinID: ALB40725
UniProt: A0A0K2LY15
LinkDB All DBs
Position
2252582..2253445
Genome map
AA seq 287 aa AA seqDB search
MNQKIAHLGPPGTYAEQAAFFYLNWLKAHSDINSQRSFELCPYSTIAQSLQAIADKRAAI
AVVPVENSIEGSVNMTMDSLWQLGNLKIQLALVLPIQHTLISYATSLDNIKTVYSHPQAL
AQCQEWISQFLPNVNLIPRNSTTEALQGLEEEVTTAAISSSRAAQLYNLPILARGINDYP
ENCTRFWVVSREENHPVDCTHTSLAFSVPANVPGALMKVLSVFAHLGINLSRIESRPTKR
SLGEYLFYLDIEADVNAQIMKSALEELRNYTEILKIFGSYSVLPINL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaaaatcgctcatttaggtccgccaggaacttatgccgaacaagcggctttt
ttttatctcaactggttaaaagcccattcggatattaattctcaaagaagctttgaatta
tgtccatattctaccattgctcagtccctacaagcaatcgccgataaacgagcagccata
gctgttgttccggtggaaaattctattgagggtagtgtcaacatgacaatggatagctta
tggcaattaggaaatttaaaaattcaattagctttagttttaccaatccaacatacatta
atttcctatgccacaagtttagataatattaaaactgtctattctcatcctcaagcgtta
gcgcaatgtcaagaatggatatcacagttcttgccaaatgtcaatttaattccccgaaat
tcaaccactgaagcactacagggattagaagaagaggtcactacagcagctatatcttct
agtcgggcggcacaattgtataatttacctattcttgccagagggattaatgattatcca
gaaaactgtactcggttttgggtagtaagcagggaagaaaatcatcccgttgattgtact
catacatctttagcctttagcgtgccagccaatgtaccaggtgcattaatgaaagtattg
tcagtatttgctcatttgggtattaatctgagtcggattgaatcgcgtccgacaaaacgt
tctttaggggaatatttattctatttggatattgaagcagatgtaaatgcacaaattatg
aaatctgctttggaagagttgcgaaattatacggaaattttgaaaatttttggtagttat
agtgtgttaccaattaatttataa

DBGET integrated database retrieval system