KEGG   Anabaena sp. wa102: AA650_14430Help
Entry
AA650_14430       CDS       T04059                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
awa  Anabaena sp. wa102
Pathway
awa00970  Aminoacyl-tRNA biosynthesis
awa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AA650_14430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:awa03029]
    AA650_14430
Enzymes [BR:awa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AA650_14430
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AA650_14430
Mitochondrial biogenesis [BR:awa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AA650_14430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF438
Motif
Other DBs
NCBI-ProteinID: ALB41503
UniProt: A0A0K2M0D0
LinkDB All DBs
Position
complement(3329437..3330918)
Genome map
AA seq 493 aa AA seqDB search
MTTATPVKTEYEAIIGLETHCQLSTNTKIFSNSSTAFGADPNTNIDPVCMGLPGVLPVLN
AKVLEYAVKTGLALNCQIARYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWIEIELVDD
AGNPSRKRIGITRLHMEEDAGKLVHAGSERLSGSTYSLVDYNRAGIPLVEIVSEPDLRTG
QEAAEYAQELRRIVRYLGVSDGNMQEGSLRCDVNISVRPVGREKFGTKVEIKNMNSFSAI
QKAIDYEIERQIAAIESGEKIIQETRLWEEGSQRTSSMRVKEGSSDYRYFPEPDLAPIEV
TQTELDSWLSELPQLPASKRHYYENELGLSAYDARVLTEDKPVADYFESAISKGANPKSA
ANWITQDIAGYLNKQKLTISEIKLTAVNLADVITRIENGKISNAQAKEKLTDLLNGVSPE
EAFAGQELISDRTILEPIIDEIIAANAQQVEKYRKGNTNLKGFFVGQVLKKTDKRAEPKL
TNQLVEEKLNAPM
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagccacacccgtaaaaactgaatatgaagcgattattggcttagaaacccat
tgtcaactcagtaccaataccaagattttctccaacagttccacagcctttggtgctgac
cccaatactaacattgatcctgtatgtatgggtttaccaggggttttacccgtacttaac
gccaaagttctcgaatacgccgtgaaaacgggtttggcgttaaattgtcaaatcgctcgg
tatagtaaatttgaccgcaaacaatatttttatcctgatttacccaaaaattaccaaatt
tctcaatatgatttacccatagccgaacatggttggatagaaattgaattggtagatgat
gcaggaaaccccagtcgcaaacgcattggtattacccgtttacacatggaagaggatgca
gggaaactcgtccacgctgggagtgaaagactttccggttctacctattctctcgtagat
tataaccgcgcggggattcccttggtagaaattgtttctgaaccagatttacggacagga
caagaagcggcggaatatgcccaagaactacggcggattgtccgctatcttggtgtcagt
gatgggaatatgcaagaaggatctctgcgttgtgatgtgaatatttctgtgcgtccggtg
ggacgagagaaatttgggactaaggtggaaattaagaatatgaactccttcagtgcgatt
caaaaagcgattgattatgaaattgaacgccaaatcgccgccattgaatcaggagaaaag
attattcaagaaactcggctttgggaagaaggttcgcaacgtaccagtagtatgcgagtg
aaagaaggttctagtgattatcgttattttcctgaacctgatttagcacccattgaagtc
acccaaacagaattagactcctggttaagtgaattaccccaactacctgcaagcaaacgc
cattattatgaaaatgagttgggactttcggcttatgatgcgcgagtcttaactgaggat
aaaccagttgcggactattttgaaagtgcaatatctaaaggtgcaaatcccaaatctgcg
gctaactggattactcaagatatcgctgggtacttaaacaaacaaaaactcaccatttcc
gaaattaaactgactgctgttaacctagctgatgtgattacccgcattgaaaatgggaaa
atcagcaacgctcaagctaaggaaaaactcacagatttactcaatggtgtttccccagaa
gaagcctttgcaggtcaagaactgatttcagatcgtaccattcttgaaccgatcattgat
gaaatcatcgccgctaatgctcaacaagtcgaaaaataccgcaaaggtaacaccaacctc
aaaggctttttcgtgggacaagtcctgaaaaaaaccgataaacgcgcagaacccaaactc
accaatcaattggtagaagagaaactcaatgcaccaatgtag

DBGET integrated database retrieval system