KEGG   Anabaena sp. wa102: AA650_18715Help
Entry
AA650_18715       CDS       T04059                                 

Definition
(GenBank) glutathione S-transferase
Organism
awa  Anabaena sp. wa102
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_C_5
Motif
Other DBs
NCBI-ProteinID: ALB42213
UniProt: A0A0K2M2C4
LinkDB All DBs
Position
complement(4260802..4261473)
Genome map
AA seq 223 aa AA seqDB search
MSNIQLYYTKGSTFSQRTRVVLLEKGIDFTPIEIDLQHKPEGFTNISRYGKVPAIKHGDV
EIYESAIINEYLEEVFPEPALLPHDPAKKAVARIWIDYANTRLVPAFNKLLRGKDTQEQE
QGRREFLESLLYIEEEGLGKLSGNGPYWLGENLSLVDISFYPWFERLPVLEKLRNFTLPT
ETPKLQQWWENLRQRESIQQVANPTEFYVERFAKILGLTVPTA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacattcaactttattacactaaaggttctactttctcccaaagaactcgtgtg
gttttactggaaaaaggaattgattttacacccattgaaattgatttacagcacaaacca
gaaggttttaccaatatttctcgttacggtaaagttccagcgattaagcatggagatgta
gaaatatatgagtccgcaattatcaatgagtatttagaagaagtatttcctgaacccgct
ttgttacctcatgatcctgctaaaaaagcagttgcgagaatttggattgactacgctaat
actcgtttagtcccagcttttaataaattactgcgtggtaaagatacccaggaacaagaa
caaggacgaagagagtttttagagtctcttttatatattgaggaagaaggattaggtaaa
ctttctggtaatggtccttactggttaggagaaaatctgagtttagtggatattagcttc
tatccttggtttgaaagattaccagttttagaaaagttacgtaattttacactgccaaca
gaaacacccaaattgcagcaatggtgggaaaatttgcgccaacgtgaatccattcaacaa
gttgctaatcctacagaattctatgtagagagatttgctaaaattctcggtttaacagtc
ccaacggcgtaa

DBGET integrated database retrieval system