KEGG   Anabaena sp. wa102: AA650_20900Help
Entry
AA650_20900       CDS       T04059                                 

Definition
(GenBank) glycosyl transferase
  KO
K19003  1,2-diacylglycerol 3-beta-glucosyltransferase [EC:2.4.1.336]
Organism
awa  Anabaena sp. wa102
Pathway
awa00561  Glycerolipid metabolism
awa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AA650_20900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:awa01003]
    AA650_20900
Enzymes [BR:awa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.336  monoglucosyldiacylglycerol synthase
     AA650_20900
Glycosyltransferases [BR:awa01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   AA650_20900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_4 Glyco_tranf_2_2 CAP59_mtransfer Chitin_synth_2
Motif
Other DBs
NCBI-ProteinID: ALB42585
UniProt: A0A0K2M3F1
LinkDB All DBs
Position
complement(4735185..4736597)
Genome map
AA seq 470 aa AA seqDB search
MPANSCPENDAYNGNSDPLDSIFTDLSVDEESEVRTDSASLPPGRFKGRRGKAALVLTIV
WSGTITLHLVSWGSIFVLGLTTMLGIHALGIIFAKPRHHSQEIEGDLPFVSVLVAAKNEE
AVIGRLVKNLCNLEYGNGQYEVWIIDDNSTDNTPQLLAQLKQEYQQLNVFRRDSDAIGGK
SGALNQVLPLTKGDIIAVFDADAQVTPDLLLQIVPLFQKEQVGAVQMRKAIANAKENFWT
KGQMAEMLLDIWFQQQRTAIGGIGELRGNGQFVRRQALASCGGWNEETITDDLDLTIRLH
LDKWDIECVFYPPVQEEGVTNATALWHQRNRWAEGGYQRYLDYWDLILQNRMGTRKTWDL
LIFMVTMYILPTAAIPDILMAIARHRPPMLSPVTGLSLGMSVVGMFAGLKHVRSDQQFKP
STYLMVLLQTLRGSLYMLHWLVVMSSTTARMSFRPKRLKWVKTVHTGVEK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgaattcctgtcctgaaaatgatgcttataacggaaactctgatccccttgac
tctatctttactgacctatcagtagatgaggaatcagaagtaaggacggattccgcgtct
ctaccaccaggccgatttaaaggacgtagaggcaaagctgctctagttttaactatagtc
tggagtggtactattaccttgcatttagtttcctggggttcgatatttgtcctcggactg
acaacaatgctaggtattcatgctttggggattatttttgccaaaccccgtcaccattcc
caagagatagagggggatttgccttttgtctctgtgttagtggctgctaaaaatgaggaa
gcggtaattggcagattagttaaaaatctgtgtaatctggaatacggtaatggtcaatat
gaagtctggattattgatgataatagtacagacaatacaccccaattactcgcccaactc
aagcaggaatatcaacaactcaatgtatttaggcgtgattctgacgctattggcggcaaa
tcgggggcattaaatcaagtattaccactgacaaagggagacattattgctgtatttgat
gctgatgcccaagttacaccggatttgctattacaaatagttcctttatttcaaaaagaa
caggtaggggcggtacaaatgcgtaaagcgatcgccaatgctaaggaaaatttttggact
aagggacaaatggcggaaatgttgttggatatttggtttcaacaacagcgcactgctatc
ggtgggattggtgaactccgcggaaatggtcaatttgtccgtcgtcaagctttggctagt
tgcggtggttggaatgaggaaactatcactgatgatctggatttaactatccggttacat
ctagataaatgggatattgaatgcgttttttatcctccggtgcaagaagaaggtgttact
aatgctacagccctttggcatcaacgtaaccgatgggcagaaggtggttatcaacgttat
ttagactactgggatctgatcctccaaaaccgtatggggacaaggaaaacctgggatttg
ttgatctttatggtgacaatgtatattttgccaacagcagcaataccagatattttaatg
gcgatcgctcgtcatcgtccccccatgttaagtcctgtaactggcttatctttgggaatg
tcagtagtaggaatgtttgctggtttaaagcacgtccgttccgatcaacaatttaaacca
tctacctatttaatggtacttttacaaacccttcgcggcagtttatatatgttgcattgg
ttagtagttatgagtagcaccacagcgcgaatgtctttccgaccaaaacgcctcaaatgg
gtgaaaactgtccatacaggtgttgagaaataa

DBGET integrated database retrieval system