KEGG   Anabaena sp. wa102: AA650_22330Help
Entry
AA650_22330       CDS       T04059                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
awa  Anabaena sp. wa102
Pathway
awa00010  Glycolysis / Gluconeogenesis
awa00053  Ascorbate and aldarate metabolism
awa00071  Fatty acid degradation
awa00280  Valine, leucine and isoleucine degradation
awa00310  Lysine degradation
awa00330  Arginine and proline metabolism
awa00340  Histidine metabolism
awa00380  Tryptophan metabolism
awa00410  beta-Alanine metabolism
awa00561  Glycerolipid metabolism
awa00620  Pyruvate metabolism
awa00625  Chloroalkane and chloroalkene degradation
awa01100  Metabolic pathways
awa01110  Biosynthesis of secondary metabolites
awa01120  Microbial metabolism in diverse environments
awa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:awa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA650_22330
   00053 Ascorbate and aldarate metabolism
    AA650_22330
   00620 Pyruvate metabolism
    AA650_22330
  Lipid metabolism
   00071 Fatty acid degradation
    AA650_22330
   00561 Glycerolipid metabolism
    AA650_22330
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AA650_22330
   00310 Lysine degradation
    AA650_22330
   00330 Arginine and proline metabolism
    AA650_22330
   00340 Histidine metabolism
    AA650_22330
   00380 Tryptophan metabolism
    AA650_22330
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AA650_22330
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AA650_22330
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AA650_22330
Enzymes [BR:awa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AA650_22330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh NYD-SP28
Motif
Other DBs
NCBI-ProteinID: ALB42825
UniProt: A0A0K2M430
LinkDB All DBs
Position
5064069..5065454
Genome map
AA seq 461 aa AA seqDB search
MITNELPKHAEIIAKQRQFFQSSKTKDVTFRIAQLKVLKQLVIENKAAIIQALKADLNKP
EFESYATEIGVNKEIDYAIKHINTWTKPKKAAVPLDLFPYSAKICPEPLGVVLIIGPWNY
PFQLIISPLVGAIAAGNCTIIKPSELAPRTSDLITKLIHKYFSPEYITVVPGAVETSQKL
LAEKFDHIFFTGGTAIGKIVMEAAAKHLTPVTLELGGKSPCIIDTDINLEHTVKRIIWGK
FINAGQTCIAPDYLLVDTKIKPNLVNALQKCLQEFYGENPANSADYARIIHQKHFDRLAN
LLKCGEVIMGGETKPEELYIAPTLLENVSLTDPVMQEEIFGPILPIIEYTDINEAITLIN
SRPKPLALYLFSQNKNLQKRILQETSSGGVCINDTVMQVAVSSLPFGGVGDSGMGSYHGK
AGFDTFSHYKSVLQNSFPLDINWRYAPYLGKLSLLKKIIGI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgattactaacgaattaccaaaacacgctgagattattgctaaacaacggcagtttttc
caaagtagtaaaacgaaagatgttacttttcggattgcccaactcaaagtccttaaacag
ttagtaattgagaataaagcagcaattattcaggcattaaaagctgatttaaataaacca
gaatttgagagttatgctacggaaatcggtgttaataaagaaattgattatgccatcaaa
catatcaatacttggacaaaacccaaaaaagcagccgttcctttagatttatttccatac
tcggctaaaatatgtccagaacccttaggagtagttttaattattggaccttggaattat
ccatttcagttaattatctcacctttggttggggcgatcgctgcgggaaattgtactatt
attaaaccttcagaactcgcaccgcggacttcggatttaattacaaaacttattcataaa
tacttttctccagaatatattacagttgtccctggtgcagtggaaacgagtcaaaagtta
ctagcagaaaaatttgatcacatcttttttactggtggtacagccattggtaaaatagtt
atggaagctgctgccaaacatctcactccggtaactttggaattgggtggaaaaagtcct
tgcatcattgatacggacattaatctagaacataccgtcaaacgcattatttggggtaaa
tttattaatgctggacaaacttgtattgccccggattatttgttggtagatacgaaaatt
aaaccaaatttagtcaatgctttgcagaaatgtctgcaagaattttatggggaaaatcca
gctaacagtgccgattatgccagaattattcatcaaaaacattttgacagattagcaaat
ttactcaagtgtggtgaagtgattatggggggagaaactaaacctgaagaactttatatt
gcccccacgctactggaaaatgtttctttaacagatccggtaatgcaagaggagattttt
ggaccgattttaccaattattgaatatacagatatcaatgaagctattactttaattaac
tctagaccaaaacccctggctttatatttattttcccaaaacaaaaacctgcaaaaacgg
attttacaggaaacatcatctgggggagtatgtattaatgacacagtaatgcaggttgct
gtttcttccttaccatttgggggtgtgggtgatagtgggatgggtagctatcacggtaaa
gctggttttgataccttttcccattacaaaagtgtcttacaaaactcatttcctttggat
ataaactggcgatacgcaccctatctaggtaaattatcgctgttgaaaaaaattattggt
atttaa

DBGET integrated database retrieval system