KEGG   Anabaena sp. wa102: AA650_22760Help
Entry
AA650_22760       CDS       T04059                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
awa  Anabaena sp. wa102
Pathway
awa00500  Starch and sucrose metabolism
awa01100  Metabolic pathways
awa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:awa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AA650_22760
Enzymes [BR:awa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     AA650_22760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: ALB42900
UniProt: A0A0K2M4A5
LinkDB All DBs
Position
5161210..5163774
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPSRLEPLRKLAYNLHFDWNVESKDLFRRLDPDLWESTHHNPVLMLGT
ISQSRLLEVVEDEGFLAQVDRAARQLEDYLQEYTWYKKQRNQHQKECYAYFSAEFGLVDC
LPIYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYLINDFHNM
PLHLERNPDGTELRIAVDYPGRKVYARVWRVQVGTVPLYMLDTNIEPNKAYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYEVTAYHMNEGHAAFSALERIRILIQEKGLNYRE
AKQVVSSSNIFTTHTPVPAGIDLFAPDKMLHYLGYYADIFGLPKEQFLGLGRENTGDLSA
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWQKVPVEEVPIAAITNGVHARSCVSKS
TQELYDRYLGPNWSSAPPDSQLWERMDAIPDEELWRNHERCRLDMVLYVREHLVKHLRDR
GASASDIIQAQEVLDPNVFTIGFARRFATYKRATLWMRDLERIKKILLANKHRKVQFVIA
GKAHPKDIPGKELIRDINRFIREHHLEKQVVFVPNYDIHIARLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGENYDDPNYQDEIEANALYELL
EKEVIPLFYDHRDGDGLPRPWVAKMKDAIRLNCPFFNTARMVREYAMRAYFPASDRYHTL
TVDNYSPAKELAAWRSKLGEHWFNIKIKDVDVSAASDIEVNQTVAVKAKVDLATLKNDDV
QVELYQGSIDANGDIVNAVPVIMDYQGQDPENSSLYTANITYTTSGLQGLSLRVLPRNQY
LSSPYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgtacttttaatgtatctccttcactaccatccagactagaacccctg
cggaaactagcctataatctccattttgattggaatgtggagagcaaagacctgtttcgt
cgtttagatcctgatttatgggaatctacccaccataatccagtattgatgctgggaact
atcagtcaaagccgactattagaagttgttgaagatgaaggctttttagcgcaagtagac
cgagcagcgcggcagttagaagattatttgcaggaatatacttggtataaaaaacaaaga
aatcagcaccagaaggaatgttacgcctatttttctgctgaatttgggttagtagattgc
ttacctatctattcaggtggtttgggtgtactcgcaggagatcacctgaaatctgcgagt
gatttgggattacctttggtgggtgtgggcttattatatcaacaaggctactttgcccag
tatcttaatgctgatggttggcagcaggaacgctacctcatcaatgatttccataatatg
cccttgcatttggaacgcaaccccgatggtacagaattacggattgcggtagattatcct
ggacgcaaggtatatgcacgggtgtggcgtgttcaggtagggacagtacccctgtatatg
cttgatactaatattgagccgaataaggcttatgaccacgatatcaccgatcagttgtat
ggtggtgatatagatatgcgtatccatcaggagattatgctggggataggtggggtgcaa
atgctcaaagccttgggctatgaagtcactgcttaccacatgaatgaaggtcatgcggct
ttctcggctttagaacgcattcgcattctgattcaggaaaaaggactgaattacagagaa
gctaaacaggtggtgtcttctagtaatattttcactacccacactccagttcccgcggga
attgacttgtttgctcctgataagatgttgcattatttgggttactatgcagatatcttt
ggtttaccgaaagagcagtttttaggtttgggacgagaaaatactggtgatttgtctgca
cctttcagtatggcagttttagcactgaagatggcgacattctctaatggtgtggcacaa
ttgcatggtgttgtttcccgccagatgttccaaggtttgtggcagaaagttcctgtggaa
gaagtaccaattgctgctattactaacggtgtccatgcccgcagttgtgtaagtaaatcc
acgcaagagctatacgatcgctatcttggtccaaattggtcatcagcaccacctgatagc
caattgtgggaacgcatggatgcaattcccgatgaggagttatggcggaatcacgagcgc
tgccgtttggatatggtgttgtatgttcgagaacatttagtcaaacatttgcgcgatcgc
ggtgcttctgcttccgatatcattcaggcacaagaggtgcttgatcctaacgtttttacc
attggctttgcccgtcgttttgctacttacaaacgcgctactctatggatgcgtgatttg
gaaagaattaaaaagattttactcgctaacaaacaccgcaaggtgcagtttgtgattgct
gggaaagcacatcctaaagatattcctggtaaagaattaattcgggatattaaccgcttt
atccgcgaacaccatttagaaaaacaggtggtatttgtccctaactacgatattcacatc
gcccgcttaatggtagcaggttgtgatatctggttaaatactccccgtcgtccccgtgaa
gcttctgggacaagtggcatgaaagctgctatgaatggtttaccaaatctcagtgttctt
gatggttggtgggatgaagcggactatgttcgcactggttgggcaataggacatggtgaa
aactatgatgatcctaattaccaagatgaaatagaagctaacgccctctatgagttgtta
gaaaaggaagttattcccctattctatgatcatcgtgatggtgatggtttgcctcgtcct
tgggtagcaaaaatgaaagatgcgattcggttgaattgtcctttctttaatacagcccgg
atggtgcgagaatatgcaatgagagcttatttcccggcgagcgatcgctatcataccctc
accgttgataattacagcccagccaaggaattagccgcctggagatcaaagttaggtgaa
cactggtttaacatcaaaatcaaagatgttgacgtatccgcagcatcagacattgaagtt
aatcaaactgtagcggtgaaagctaaggtagatttagcaactttgaaaaatgatgatgtg
caagtagaactatatcaaggttctattgatgccaacggtgatatcgtcaatgctgtacct
gtaatcatggattatcaaggacaagatccagaaaattccagtctttataccgcaaatatc
acctacacaacttctggtttgcaaggtttatctttgcgtgtcttacctcgaaatcaatac
ctctctagcccttatgaacccagattaatcgcttgggcggaataa

DBGET integrated database retrieval system