KEGG   Aliivibrio wodanis: AWOD_I_0292Help
Entry
AWOD_I_0292       CDS       T03808                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
awd  Aliivibrio wodanis
Pathway
awd00620  Pyruvate metabolism
awd00680  Methane metabolism
awd01100  Metabolic pathways
awd01120  Microbial metabolism in diverse environments
awd01200  Carbon metabolism
Module
awd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:awd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWOD_I_0292 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    AWOD_I_0292 (ppc)
Enzymes [BR:awd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AWOD_I_0292 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CED70387
UniProt: A0A090IJK0
LinkDB All DBs
Position
1:complement(331967..334597)
Genome map
AA seq 876 aa AA seqDB search
MNEKYAALKSNVSMLGHLLGNTIRDAHGEELLAKVETIRKLSKTARAGSDDDRNALIEEI
KSLPDDQLTPVARAFSQFLNLTNMAEQYHTISRHCEAHVCEPDAISTLFSKLSQNNVSKL
DTAQAVRELNIELVLTAHPTEIARRTMINKLVKINECLSKLELGDISFSERDKTERRLEQ
LIAQAWHSDVIRQERPTPLDEAKWGFAVVENSLWQGIPDFLREFDQRLEGHLGEGLPIDA
RPVHMSSWMGGDRDGNPFVTHTITREVMLLSRWKAADLYLKDINELISELSMVKCSDEVR
ELAGDQHEPYRAILKQLRVLLGDTLESLDAQMKGERAPNKTILTDADQLWAPLYACYQSL
HACGMGIIAEGSLLDTLRRVKAFGAHLVRLDIRQESTRHSDVLSELTRYLGIGDYDQWSE
QDKISFLVNELSSKRPLLPRNWEPSPEVQEVIDTCKVVAEQSKEALGSYVISMARTASDV
LAVHLLLQEAGCPFRMDVCPLFETLDDLNRSKEVMEQLFSIDWYRGFIQNHQMVMIGYSD
SAKDAGVMSAGWAQYSAMEALVEVCEKESIELTLFHGRGGTIGRGGAPAHAALLSQPPKS
LKGGLRVTEQGEMIRFKLGLPEVAVNSFNLYASAILEANLLPPPEPKQDWRDLMEVLSEV
SCEAYRNVVRGEKDFVPYFRAATPELELGKLPLGSRPAKRNPNGGVESLRAIPWIFSWSQ
NRLVLPAWLGAGEAIQYSIDKGHQELLEEMCREWPFFSTRLGMLEMVYTKCNPQMSEYYD
QRLTDKSLWPLGERLRNQLQADIKAVLNVENSDHLMESDPWGSESIKLRNIYVDPLNMLQ
AELLFRTRQQEDTSPELEEALMVTIAGISAGMRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaagtacgctgctttgaaaagcaatgtcagcatgttgggtcacttacttgga
aacacgattcgagacgcacatggtgaagagctattagcaaaagttgaaaccattcgtaag
ctgtctaaaacagcacgcgcaggaagcgacgatgaccgtaatgcactgattgaagaaatt
aaaagtcttccagatgatcaactaactccagttgctcgtgcattcagtcagttcctaaat
ttaaccaatatggcagagcagtaccatacgatttcacgtcattgtgaagcacacgtatgt
gaacctgatgctattagcaccctattctctaaactaagccaaaataacgttagtaagttg
gatacagcacaagcggttcgtgaattaaacattgagcttgttttaacggcacatccaacc
gaaattgcacgtcgcactatgatcaacaagttggtgaaaatcaacgaatgtttatcaaag
cttgagcttggtgatatctctttctctgaacgtgataaaacggaacgtcgacttgaacaa
ctgattgctcaagcgtggcactctgatgttatccgtcaagaacgcccaaccccattagac
gaagcaaaatggggctttgccgttgttgagaactcgttatggcaaggtattccggatttc
ttacgtgaattcgaccaacgtttagaaggtcaccttggtgaaggtcttccaattgatgct
cgtcctgtgcatatgtcctcttggatgggcggtgaccgtgatggtaacccgtttgtaaca
cacactatcactcgtgaagtaatgcttctttctcgctggaaagccgctgatctgtacttg
aaagacattaacgaattgatcagtgaactttcgatggtgaaatgttctgatgaagttcgt
gagctagcaggtgatcaacacgaaccttaccgtgcgatcctaaaacagcttcgtgtatta
ctaggcgacacacttgaaagcctagatgcacaaatgaaaggtgaacgagcgccgaataaa
acgattcttaccgatgctgaccaactatgggcaccactgtatgcgtgttatcaatcactg
catgcttgcggtatgggtatcattgcagaaggttcactattagatacattacgtcgtgtg
aaagcgtttggggctcatcttgttcgtcttgatattcgccaagaaagtactcgtcactca
gatgttctatcagagctgactcgttacttaggcattggtgattacgatcagtggagcgag
caagacaaaatctctttccttgtgaacgagctaagctctaagcgccctcttttacctcgt
aattgggagccatctcctgaagttcaagaagttatcgacacctgtaaagtcgttgctgag
caatctaaagaagcgttaggctcttatgttatttcaatggctcgtactgcatctgatgta
ctggctgttcacttattacttcaagaagctggttgtccattccgtatggatgtttgtcca
ctgtttgaaacgctagacgatttaaaccgctcaaaagaagtgatggaacagttattctcc
attgattggtatcgtggatttatccagaaccatcaaatggtaatgatcggttattcagac
tcagcaaaagatgctggtgtaatgtcagcaggttgggcgcaatacagcgcgatggaagca
ctggttgaagtgtgtgagaaagagagcattgagcttactttattccacggccgtggcggt
actattggtcgtggcggcgctccagcgcatgcagctcttctgtctcagccaccgaaaagt
ttaaaaggcggtttacgcgtaacagaacaaggtgaaatgatccgctttaaattgggtcta
cctgaagttgctgtaaacagctttaacctatacgcaagtgcgatccttgaagctaacctt
ctgccaccaccagagccaaaacaagattggcgtgatctgatggaagtcctgtctgaagtg
tcatgtgaagcctaccgtaatgtggttcgtggcgaaaaagactttgttccttacttccgt
gcagcaacaccggagttagaattaggtaaacttccgctaggatctcgccctgctaagcgt
aacccaaatggtggcgttgaaagcttacgtgctattccatggatcttctcatggagtcaa
aaccgtttggttcttcctgcgtggctaggtgctggtgaagcaattcaatattcaattgat
aagggtcatcaagagctattagaagagatgtgtcgtgaatggcctttcttctctactcgt
cttggtatgcttgagatggtttacaccaagtgtaatccacaaatgtctgaatactacgat
caacgtttaacagacaaatctctatggccactaggtgagcgtctacgtaatcaattacaa
gcggatattaaagcggtattgaacgtagagaacagcgatcacttaatggaaagtgaccca
tggggttcagagtcaatcaagctacgtaatatctatgttgatccactaaacatgctgcaa
gctgaactgctgttccgtactcgtcaacaagaagatacatcaccagagcttgaagaggct
ctaatggttacgattgcaggtatttctgcaggtatgcgtaacactggttaa

DBGET integrated database retrieval system