KEGG   Aliivibrio wodanis: AWOD_I_0874Help
Entry
AWOD_I_0874       CDS       T03808                                 

Definition
(GenBank) pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
awd  Aliivibrio wodanis
Pathway
awd00250  Alanine, aspartate and glutamate metabolism
awd00410  beta-Alanine metabolism
awd00430  Taurine and hypotaurine metabolism
awd00650  Butanoate metabolism
awd01100  Metabolic pathways
awd01110  Biosynthesis of secondary metabolites
awd01120  Microbial metabolism in diverse environments
awd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:awd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AWOD_I_0874
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AWOD_I_0874
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AWOD_I_0874
   00430 Taurine and hypotaurine metabolism
    AWOD_I_0874
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AWOD_I_0874
Enzymes [BR:awd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AWOD_I_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF5446 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CED70967
UniProt: A0A090IKY7
LinkDB All DBs
Position
1:complement(1031307..1032950)
Genome map
AA seq 547 aa AA seqDB search
MVTDNKTADANLESMLRIFTVPEAPDSTLGKIEQELSQNLNQFLREHIVAEEKPLSEIEK
DFTDPSMPESPTYVSEHTEHLLDTLVSQSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGILHRLIYSKKDNFYQHWMHSADHSLGAFCSGGTIANITA
LWVARNRLLQPDGDFEGIAKQGLFAALTHYKCNGLAIFVSERGHYSIKKAADVLGIGQDG
VIAVKTDNNNRICLTDLEKKIAAVKANNIKPLAIIGVAGTTETGSIDPLRKLAQIAQQEG
CHFHVDAAWGGATLMSNTYRDLLDGIDLADSVTIDAHKQLYVPMGAGMVIFKDPELMSSI
QHHAEYILRKGSKDLGRHTLEGSRSGMAMLLYSCFNVISRPGYELLINQSIEKAKYFSEL
IQQQDDFEIVSKPELCLLTYRYVPSKVKAALKIASANQTAEIYEHLDNLTKYIQKTQRET
GKSFVSRTRLTPRAYQYNPTIVFRVVLANPLTTKEILQNVLIEQREIASSSKISLPQLIT
LVDTILK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagacaacaaaacagcggatgccaatttagaaagcatgctgcgaatttttact
gttccggaagctcccgattcgactcttggaaaaattgagcaagaactctctcaaaacctg
aatcaattcttacgagaacatattgtcgcagaagagaaacctctcagcgaaattgaaaaa
gattttactgatccttcaatgccagaatctcctacctatgtttctgagcataccgagcat
ttactagatactctagtttctcaatctgttcatacttcagcaccaagttttattggtcat
atgacatcagcattgccttattttttaatgccgctgtcaaaaatcatgatcgcgttaaac
caaaacttagtgaaaattgaaacctctaaagcgtttacaccactagagcgtcaagtattg
ggcattttgcatcgtcttatttatagtaagaaagataatttctaccaacattggatgcac
agtgccgatcactctttaggtgctttctgttcaggtggaaccattgccaatatcactgca
ttatgggtagcaagaaaccgtttattacagccagatggcgactttgaaggtattgcaaag
caaggcttatttgctgcattaactcattataaatgcaatggccttgctatttttgtttct
gaacgtggtcactactccatcaaaaaagccgctgacgtattagggattggtcaagatgga
gttatcgcggtaaaaacagacaataataatcgtatttgtttaaccgatttagagaaaaaa
atagcggcagtaaaagcaaacaacattaaaccactagctattatcggtgttgcaggtaca
acagaaacaggcagtattgatccattacgtaaattagctcaaatcgctcaacaagaagga
tgtcattttcatgttgatgcagcttggggtggtgcgacactgatgtctaacacatacaga
gacttactcgatggtatagatttagccgactctgtcactattgatgcccacaaacaactt
tatgtcccaatgggcgcaggcatggttatctttaaagatcctgaattaatgtcttctatt
caacatcatgctgagtatatcttacgtaaaggttctaaggatctaggacgccatacccta
gagggttctcgtagtggaatggcaatgttgctttattcttgtttcaatgtgatcagtcgt
ccaggctatgaactattgattaaccaaagcattgaaaaagcaaaatacttttcagagcta
attcaacaacaagatgactttgaaattgtttctaaacctgaactttgcctgctaacctat
cgttacgtaccaagcaaagtaaaggcagcactaaaaattgcaagcgctaatcaaacagcc
gaaatttatgaacatttggataatttaaccaaatacattcaaaagactcaacgagaaaca
ggtaagtccttcgtctctcgaactcgactaacaccacgagcataccaatataacccaacg
attgtctttcgagtggtattagccaacccgctaaccaccaaagaaattttacaaaatgtg
ctaattgagcaacgagaaatcgcaagtagcagtaaaatatctttaccacaactgataacg
cttgttgatacgattctaaagtaa

DBGET integrated database retrieval system