KEGG   Aliivibrio wodanis: AWOD_I_0904Help
Entry
AWOD_I_0904       CDS       T03808                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
awd  Aliivibrio wodanis
Brite
Enzymes [BR:awd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AWOD_I_0904 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CED70997
UniProt: A0A090IL18
LinkDB All DBs
Position
1:complement(1067174..1067758)
Genome map
AA seq 194 aa AA seqDB search
MSFELPALPFAKDALLPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWNCLAPQAGGEPTGAVAEAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLEIVNTSNAATPLTEEGVTPLLTVDLWEHAYYIDFRNVRPDYMAAFW
ALVNWSFVEENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgaattaccagctctaccgttcgcaaaagatgcactattaccacacatctca
gctgagactttagattaccaccacggtaaacaccacaatacttatgtggttaagcttaac
ggtcttatcccaggtactgaatttgaaggcaaaactctagaagagatcatcaaaacttct
actggtggcgttttcaataacgcagcgcaaatctggaaccacacgttctactggaactgt
cttgctcctcaagctggtggcgaaccaactggcgctgttgcagaagctatcaacgctgca
ttcggttctttcgaagaattcaaagcgaaattcacagattctgcaatcaacaactttggt
tcttcttggacttggttagttaaaaaagctgacggctctctagagatcgttaacacttct
aacgcagctactcctctaacagaagaaggggttactccgcttctaactgttgacctatgg
gaacacgcttactacatcgatttccgtaacgtacgtcctgactacatggctgcgttctgg
gctcttgtaaactggtcttttgtagaagaaaacctagctaagtaa

DBGET integrated database retrieval system