KEGG   Aliivibrio wodanis: AWOD_I_1704Help
Entry
AWOD_I_1704       CDS       T03808                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
awd  Aliivibrio wodanis
Pathway
awd00240  Pyrimidine metabolism
awd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AWOD_I_1704 (tdk)
Enzymes [BR:awd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AWOD_I_1704 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Cas_Csn2 AAA_22 DUF4528
Motif
Other DBs
NCBI-ProteinID: CED71772
UniProt: A0A090IMT7
LinkDB All DBs
Position
1:complement(1958372..1958950)
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMNPAIFTAAIDDRYGVGKVSSRIGLDADAH
LFNKDMDLFEAIKTLHEKKKLHCVLIDECQFLTKEQVYQLTEVVDKLNIPALCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGVAIADGDQVAIGGNELYVS
VCRLHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaaatgtacttttattactcagcaatgaatgcgggtaaatcaacaacacttctt
caatcatcttttaattatcaagagcgtggtatgaatcctgcgatctttacagcagcgatc
gatgatcgttacggagtggggaaggttagttcacgtatcggtttagatgctgatgcacac
ttattcaataaagacatggatttatttgaagcaattaaaacgcttcatgaaaaaaagaaa
ttgcactgtgtattgattgatgaatgtcagtttttaacaaaagagcaagtttatcaatta
acagaagttgtcgataaattaaatattccagcattatgttatggtttaagaacagacttc
ctaggtgagttgtttgaaggcagtaaatacttattatcatgggcagataagttggttgaa
ctaaaaaccatctgtcattgtggtcgtaaagcgaatatggttattcgtactgacgagcat
ggtgttgctattgctgatggtgatcaggttgcgataggtggtaatgaactgtatgtttct
gtatgtcgtcttcactataaagaagcgctaggcaagtaa

DBGET integrated database retrieval system