KEGG   Acetobacterium woodii: Awo_c00400Help
Entry
Awo_c00400        CDS       T01732                                 

Gene name
oppD3
Definition
(GenBank) oligopeptide ABC transport system ATP-binding protein OppD3
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
awo  Acetobacterium woodii
Pathway
awo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:awo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Awo_c00400 (oppD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:awo02000]
    Awo_c00400 (oppD3)
Transporters [BR:awo02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Awo_c00400 (oppD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 oligo_HPY ABC_ATPase SMC_N AAA_23 AAA_16 AAA_22 RsgA_GTPase DUF815 MMR_HSR1 NB-ARC MobB RNA_helicase G-alpha DUF5300 AAA_18 DUF3987
Motif
Other DBs
NCBI-ProteinID: AFA46854
UniProt: H6LEE0
LinkDB All DBs
Position
43727..44512
Genome map
AA seq 261 aa AA seqDB search
MQETLLKLQNVEISYNGEPMVTNVNLDMKAGEILGIVGESGSGKSTLIKAAMGLLDPAGL
VNKGEIFYKGQNVLELSDEKLRTIRGPEMGMIFQNCGSALCPIRTIGDQLYETMEQHGFK
DREAVKKRAEKLFNKINLKDCDRILNSYPFELSGGMNQRVGIVMAMILEPELLLADEPTS
ALDVTVQAQVIQEMMALRDEFGTGIVIVTHNIGVVSYMADQVAVMCKGKVVEYGKTRDVI
DHPQKAYTRELIQAVPRIRRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaacattactaaaactgcaaaatgtcgaaatatcctataacggcgaaccgatg
gttaccaatgttaacctggatatgaaagcgggtgagattcttggtattgttggggaatcc
ggcagcggaaaaagtacgttgatcaaagcggcgatgggtcttctggacccggccggtttg
gttaataaaggcgagatcttttataagggacaaaatgtgttggaacttagtgatgaaaaa
cttcggacgatacgtggtccggaaatggggatgattttccagaactgcggcagtgcgttg
tgtccgattcgaaccattggtgatcaactttatgaaaccatggagcagcacgggtttaaa
gatcgtgaagcggttaaaaagcgggccgaaaagctgttcaataagattaacctaaaagac
tgtgaccgaattttaaatagttatccctttgagttatcgggcggaatgaatcagcgggtg
ggcattgtgatggcgatgattctggagccggaactacttttggccgatgaaccaacctcc
gctttggatgtaaccgttcaggctcaagtgattcaggaaatgatggcgctgcgggatgaa
ttcggaactgggattgtcatcgttacgcataatatcggggtggtttcttatatggcagat
caggtggcagtgatgtgtaaaggcaaagtggttgaatatgggaagacccgggatgtcatt
gatcatccccagaaagcatataccagagagctgattcaggccgtgccgagaattcgaaga
gggtga

DBGET integrated database retrieval system