KEGG   Acetobacterium woodii: Awo_c02990Help
Entry
Awo_c02990        CDS       T01732                                 

Gene name
gatA2
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A2
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
awo  Acetobacterium woodii
Pathway
awo00970  Aminoacyl-tRNA biosynthesis
awo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:awo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Awo_c02990 (gatA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:awo03029]
    Awo_c02990 (gatA2)
Enzymes [BR:awo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Awo_c02990 (gatA2)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Awo_c02990 (gatA2)
Mitochondrial biogenesis [BR:awo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Awo_c02990 (gatA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Cofac_haem_bdg
Motif
Other DBs
NCBI-ProteinID: AFA47108
UniProt: H6LGH2
LinkDB All DBs
Position
347871..349343
Genome map
AA seq 490 aa AA seqDB search
MELSQKTIHEINDLLDKKEVTVTEVTQAVVNRINSVEKATDAYLSLQTEAALETAKTLDS
ELSKRDKKSPLEGIPYGLKDNMCTKGILTTCASKMLNNFNPPYNAQVYDCLTEAGGILLG
KTNLDEFAMGSSTENSAYKVTHNPWNLNKVPGGSSGGSAVAVAADSAYFALGSDTGGSIR
QPASFCGVVGMKPTYGLVSRYGLVAFASSLDQIGPFTKDVEDCALVLNAIVGHDAKDSTS
LKLAKIDYTQNLQQGVKGLKVGVAKEFFGEGLQPEVRQKLEDAIAIYKALGAEIVDVSFQ
HLDYALSAYYMISSAEASSNLARYDGIRYGFRAEEYSDLVDLYKKTRSQGFGAEVKRRIM
LGTYALSSGYYDAYYKKAMQVRTIIKEDFDQAFAGCDVLLTPTAPTTAFGIGEKTSSPLE
MYLTDIYTVPVNIAGIPGVSIPCGLDNSGMPIGMQLLGPILSEETLLKVAWAFENESGLK
NLKAPLETEV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaattaagtcaaaaaacgatacatgaaattaatgaccttctggataaaaaagaagtt
acggttaccgaggtaactcaagccgtggttaatcgcattaacagcgttgaaaaagcgacc
gacgcttacctcagcctgcaaaccgaagctgccttagaaacggctaaaactttagattcc
gagttgtctaaaagagacaaaaaaagccctctggaagggattccttatggcttaaaagat
aacatgtgcacaaaagggatcttaacgacgtgtgcatctaaaatgttaaataatttcaac
ccgccgtataatgcccaagtttatgattgtctgactgaagcgggagggattctgttggga
aaaaccaacttggatgaatttgcgatgggttcctcaaccgaaaattcggcctataaagtg
acacataatccctggaatttaaacaaggttccgggcggttccagtggtggttcagcagtc
gctgttgctgctgatagcgcttattttgcgttgggatcagatacgggcggatcaattcgg
caaccggcatcattttgcggagttgtggggatgaaaccaacctatggtttagtctctcga
tatggtctggtggcatttgcatcctccttagatcagattggtccctttactaaagatgtt
gaagattgtgccttggttttaaatgccattgttggccatgatgccaaagattcgacctcg
cttaaactggcaaaaattgactatacacaaaacttacaacaaggggttaaggggttaaaa
gtgggagtggccaaagaattttttggcgagggcttgcaaccggaagtccggcagaaactg
gaagatgccattgccatttataaagcgctgggagctgaaattgttgatgtatccttccag
catttagattatgcgctgtcagcttattatatgatttcatcagccgaagccagttccaat
ctggcccgttatgacggaatccgttatggttttagagccgaagaatatagcgatctcgtt
gacttatataagaaaacgcgcagccagggttttggcgctgaggttaaacgacggattatg
ttgggaacctatgccctcagctccggttattatgatgcttattataaaaaagcgatgcag
gtacgaacgatcattaaggaagattttgatcaggcttttgccggatgtgatgtgttatta
acaccaacagcgccaaccacagcttttgggattggcgaaaaaaccagcagtcccctggaa
atgtatttaaccgatatttatacggtgccggtaaacattgccggaattcccggggtttcc
attccttgtggtttagataacagcgggatgccgattggaatgcaattgttgggcccgatc
ttaagtgaagaaacgctcttaaaagtagcctgggcatttgaaaatgaatccggtttgaag
aatttaaaagcaccattggaaacggaggtctaa

DBGET integrated database retrieval system