KEGG   Acetobacterium woodii: Awo_c03370Help
Entry
Awo_c03370        CDS       T01732                                 

Gene name
gad
Definition
(GenBank) glutamate decarboxylase Gad
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
awo  Acetobacterium woodii
Pathway
awo00250  Alanine, aspartate and glutamate metabolism
awo00410  beta-Alanine metabolism
awo00430  Taurine and hypotaurine metabolism
awo00650  Butanoate metabolism
awo01100  Metabolic pathways
awo01110  Biosynthesis of secondary metabolites
awo01120  Microbial metabolism in diverse environments
awo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:awo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Awo_c03370 (gad)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Awo_c03370 (gad)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Awo_c03370 (gad)
   00430 Taurine and hypotaurine metabolism
    Awo_c03370 (gad)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Awo_c03370 (gad)
Enzymes [BR:awo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Awo_c03370 (gad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Sigma_reg_C
Motif
Other DBs
NCBI-ProteinID: AFA47141
UniProt: H6LH03
LinkDB All DBs
Position
complement(384610..386022)
Genome map
AA seq 470 aa AA seqDB search
MLHSRPNKDQLESVYETPVFSNDPLNSTLPKYQLNEESIDPELAYLLIKDDLLDEGSARL
NLATFCQTYMEPAAVRIMSETLEKNAIDKSEYPQTTDLENRCVNIIADLWNAPEDSAYIG
TSTVGSSEACMLGGLAMKFAWREKAKQAGIDILGRKPNLVISSGFQVCWEKFCVYWDIEM
RCVPLDPDHMSLNMDTVMDYVDNDTIGIVAIMGITYTGKYDDVKKLDELVEVYNQTAVIP
VSIHVDGASGGLFAPFIFPDLEWDFRLKNVISINTSGHKYGLVYPGIGWIVWKDKCYLPS
ELIFSVSYLGGDLPTMAINFSRSSSQIIGQYFNFLSYGYRGYQKIHERTRSVAKYIAAEL
EQTQLFDIYNDGDNIPIVCWKLKANLDKPWSLYDLADRLRTTGWQVPAYPLPDNLSDLII
QRVVVRQDLSLQLAISFINDIKASIDALDHAHIIIYGHSDENKGAMGFTH
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgttgcattcaagaccaaataaggaccaactggaaagcgtctatgaaacccctgttttt
agtaatgatccgctgaattctacgctgcctaaatatcaattaaatgaagaatcgatcgat
cctgaacttgcttatcttttaattaaagatgacttattggacgaaggcagtgcccgactt
aatctagccaccttttgtcaaacttacatggaacctgccgctgttcgaatcatgtctgag
accctggaaaaaaatgccatcgacaagtctgaatatcctcagacaactgaccttgaaaac
agatgtgtcaacatcattgccgatctctggaatgctcccgaagactcggcttatatcggc
acttcaaccgtcggttcttccgaagcctgcatgcttggcggtctggctatgaaatttgcc
tggcgtgaaaaagctaaacaagccggcattgatatcctcggccgaaaaccaaacctggtt
atttcctcgggttttcaagtttgttgggagaaattctgcgtctattgggatattgaaatg
cgttgtgtgccattagaccccgaccatatgagtttgaacatggatactgtcatggattat
gtggataacgacaccattggtattgttgccattatgggaattacttatacgggtaaatac
gatgatgttaaaaaattggatgagcttgtcgaggtctacaatcaaactgctgtgattccg
gtttctatccatgtggacggcgcctccggcggactatttgctccttttatcttccctgat
ctagaatgggatttccgactaaaaaatgttatttccattaatacctctggtcataaatat
ggtcttgtttatcccggtattggttggatcgtctggaaggacaaatgttatttgccatcg
gagctgatctttagcgtcagctatcttggcggtgatttacccacgatggccatcaacttc
tcacgatcatcaagccaaatcatcggtcaatatttcaacttcttaagctatggttatcgt
ggttatcaaaagatccacgaacgcacgcgaagcgttgcaaaatacattgctgctgagctt
gagcaaacacaactttttgatatctacaatgatggtgataatattcccatcgtttgctgg
aagctgaaagcaaatcttgacaagccctggagcctttacgacctcgctgatcgcctacgc
acaactggttggcaggttccagcttatccgctgcctgataacctctcagatcttatcatc
caacgggtagtggttcgtcaagatctaagcctgcaactggcaatctcttttatcaacgat
atcaaggcaagcatcgatgctttagatcatgctcacattataatttatgggcattccgac
gaaaacaagggtgctatgggctttactcattaa

DBGET integrated database retrieval system