KEGG   Acetobacterium woodii: Awo_c12480Help
Entry
Awo_c12480        CDS       T01732                                 

Gene name
tktB2
Definition
(GenBank) transketolase, subunit B
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
awo  Acetobacterium woodii
Pathway
awo00030  Pentose phosphate pathway
awo01100  Metabolic pathways
awo01110  Biosynthesis of secondary metabolites
awo01120  Microbial metabolism in diverse environments
awo01130  Biosynthesis of antibiotics
awo01200  Carbon metabolism
awo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:awo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Awo_c12480 (tktB2)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Awo_c12480 (tktB2)
Enzymes [BR:awo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Awo_c12480 (tktB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C TGF_beta_GS
Motif
Other DBs
NCBI-ProteinID: AFA48032
UniProt: H6LDY9
LinkDB All DBs
Position
1452943..1453893
Genome map
AA seq 316 aa AA seqDB search
MTIKKLNPRDVFGEVLLDLGRENKNIMAVSCDSGSGSGMNPFKKELPHQYLEVGINEQNA
IGVCAGLAEGGFIPIVSAIAPFISMRAFEQIRNDLGYANMNVKVIGSSSGLSHSALGSTH
QAIEDLTLMRVVPNMVVLNPGDGYEVEMSLKKAIRHKGPVYIRMPRHAMAEPLEATERNF
EIGKGEVLMNSGDDIVIAVSGTLSVDGFMAGKILDEMGYGVKVLNFTTVKPLDTKLLCEA
YKSAKYLFTLEEHSVIGGFGSAVLEALASVKHEAPIHLIGITDGSIKTGPYRELLEAYGL
TWEKVADRILNEIKNN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaaaaagcttaatccacgagacgtttttggggaggtcttattagatctcggg
cgagaaaataaaaatattatggcggtatcttgcgattcaggatcgggatcagggatgaat
ccttttaaaaaggagttgccacatcaatatttagaagttggcatcaatgagcagaatgcg
attggtgtttgtgccgggttggccgaaggcggttttattccaatcgtatcggcgattgct
ccatttatttcaatgcgtgcgttcgaacaaattcgtaatgatttgggttacgccaacatg
aatgttaaggtaattggttccagtagcggtttatctcattccgcactaggctcaacgcat
caggcgattgaagatttaacattgatgcgtgttgttcccaatatggtggtattaaatcct
ggtgacggttatgaagtagaaatgtctttaaaaaaagcgatccgtcacaaagggccggtt
tatatcagaatgccacggcatgcaatggctgaaccgcttgaagcgaccgaacgaaatttt
gagatcggtaaaggggaagtactaatgaatagcggcgatgatattgtgatcgcggtttcg
ggtactttatcagttgatggttttatggctggaaaaatattggatgagatgggttatggc
gtaaaggtattgaattttacaacagtaaaaccgttagatacaaaacttctttgtgaagcc
tataaaagtgctaagtatctctttacgttagaagaacattcggtgatcggtggttttggc
agcgctgtgctggaagctttggcatcagttaaacatgaagcccccattcatttaatcggg
attaccgatggttcgattaaaaccggtccctatcgagaattattggaggcttatggactt
acctgggaaaaagtcgcagatcgtattttaaatgaaatcaaaaataattaa

DBGET integrated database retrieval system