KEGG   Acinetobacter wuhouensis: BEN71_07320Help
Entry
BEN71_07320       CDS       T05823                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
awu  Acinetobacter wuhouensis
Brite
KEGG Orthology (KO) [BR:awu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BEN71_07320
Enzymes [BR:awu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BEN71_07320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO FAD_binding_3 NAD_binding_7 AlaDh_PNT_C Thi4 NAD_binding_8 FMO-like K_oxygenase Glutaredoxin Spermine_synth Cytochrom_C_2
Motif
Other DBs
NCBI-ProteinID: AXQ21884
UniProt: A0A385C2Y5
LinkDB All DBs
Position
1406290..1407855
Genome map
AA seq 521 aa AA seqDB search
MLDTNTSAQLKTLLERLESPIEIVASLNGTEKSDKIKELVTEVAALSDQVTARFDGENGR
KPSFGIAKVGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDEILAQIKGLNLKANF
DVFVSLSCHNCPDVVQALNLIAINNPGTTATMIDGAFFQDEVEERKILAVPMVFQNGEHI
GQGRMTLEEIVAKLDSGAAAKDAEKLNAKEAFDVLVIGGGPAGATSAVYAARKGIRTGIV
SERFGGQVMDTMDIENFISVQKTQGPKFGADMEAHVREYGVDIMNLQKVKNLVGADQTAS
GLVEIELENGAKLESKTVILSTGARWREMNVPGEKEYKTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGIEAAIDLAGIVEHVTVVEFDTKLRADQVLQNKLNSLPNTTVIMNALSTEVIGD
GSQVTALKYKDRATDEEHVVELAGIFVQIGLLPNTDFLKETAFELSNRNEIVVNDRNETN
VKGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatacaaatacttctgctcaattaaaaacattgttagaacgtcttgaaagccct
attgaaattgttgcttctttaaacggcactgaaaagtcagacaaaatcaaagaattagtc
acagaggttgctgcactttcagatcaagtgacggcacgttttgatggtgaaaatggacgt
aaaccaagctttggtatcgctaaagtgggtgaacaacctcgtgtattctttgctggcttg
ccaatggggcatgagtttacatctttgattcttgcattattacaagtgtctggttatgcg
ccaaaagtgtctgatgaaattttagcgcaaatcaaaggcttgaatcttaaagcaaacttt
gatgtatttgtgtctttaagctgccataactgtcctgatgttgttcaagctttgaactta
attgcaatcaacaatccaggtacaactgcgaccatgattgatggtgcattcttccaagac
gaagttgaagagcgcaaaatcttggctgtacctatggttttccaaaatggcgagcatatc
ggtcaaggtcgtatgactttggaagaaatcgtagcgaaactagacagcggtgctgctgcg
aaagatgctgaaaaactcaatgcaaaagaagcatttgatgttttagtgatcggtggtgga
cctgctggtgcaacttcagcggtatatgctgcacgtaaaggtattcgtacgggtattgtt
tctgaacgcttcggtggtcaggtcatggatacaatggatattgaaaactttatttcagtg
caaaaaactcaaggtccgaaatttggtgcagatatggaagcacatgtacgtgagtacggt
gtggacattatgaacctacaaaaagtgaaaaaccttgtaggtgcagatcaaactgccagt
ggtttagtggaaattgaacttgaaaatggtgcaaaacttgaatcaaaaacagtcatccta
tcgacaggtgcacgttggagagagatgaatgtacctggtgagaaagagtataaaacacgc
ggtgttgcatactgcccacactgtgatggcccattattcaaaggcaaacgcgttgctgtg
attggtggtggtaactctggtattgaagccgcaattgaccttgctgggattgtagaacat
gtcactgttgttgagtttgatacaaaactccgtgctgaccaagttttacaaaacaaattg
aacagcttgccaaataccacagtgatcatgaatgcactttctactgaagtgattggtgat
ggttcacaagtgactgcattgaagtataaagatcgtgcaactgatgaagaacatgttgtt
gaacttgcagggatctttgtacaaattggtttgttaccaaatacagatttcttgaaagaa
acagcttttgaattgtcaaatcgtaatgaaattgtggtgaatgatcgcaatgaaaccaat
gtaaaaggtgtattcgctgcgggtgactgtactactgtaccttataagcaaattatcatt
gcagcaggtgagggtgctaaagcgtcattatcagcattcgattacatcattcgttcaggt
caataa

DBGET integrated database retrieval system