KEGG   Acinetobacter wuhouensis: BEN71_13645Help
Entry
BEN71_13645       CDS       T05823                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
awu  Acinetobacter wuhouensis
Pathway
awu00020  Citrate cycle (TCA cycle)
awu00190  Oxidative phosphorylation
awu00650  Butanoate metabolism
awu01100  Metabolic pathways
awu01110  Biosynthesis of secondary metabolites
awu01120  Microbial metabolism in diverse environments
awu01130  Biosynthesis of antibiotics
awu01200  Carbon metabolism
Module
awu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
awu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
awu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:awu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BEN71_13645
   00650 Butanoate metabolism
    BEN71_13645
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BEN71_13645
Enzymes [BR:awu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BEN71_13645
    1.3.5.4  fumarate reductase (quinol)
     BEN71_13645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AXQ23056
UniProt: A0A385C778
LinkDB All DBs
Position
complement(2712474..2713184)
Genome map
AA seq 236 aa AA seqDB search
MSRGTRTFEIYRYDPDKDKAPYMQTFKLELTDKHRMLLDALLALKVEDESLTFRRSCREG
ICGSDGVNINGKNGLACLWNLNDLPEKIVIRPLPGLPVVKDLVVDMNQFYDQYDKIQPFL
INNQPAPPKERLQSPEDREHLDGLYECILCACCSTSCPSFWWNPDKFLGPSALLNAYRFI
IDSRDTATQDRLSRLDDPFSLFRCKGIMNCVSVCPKGLNPTKAIGHIRSMLLDQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaggtacccgtacattcgaaatctaccgctatgatcctgataaggataaagca
ccgtacatgcaaacttttaaacttgaattgactgataagcaccgtatgttgcttgatgct
cttcttgcattaaaagtagaagatgagtctttgactttccgtcgctcttgccgtgaaggt
atttgtggttcggatggtgtgaacatcaacggtaaaaatggtttggcttgtctttggaac
ttgaacgatttaccagaaaaaatcgtgattcgtccattgcctggtttgccagtggttaaa
gatttagttgtggatatgaatcagttctacgatcagtatgacaaaattcaaccattccta
atcaataatcaacctgcgccaccgaaagagcgtttacagtctcctgaagatcgtgaacat
cttgatggtttgtatgaatgtattctttgtgcatgttgttcaacttcatgcccatcattc
tggtggaaccctgataaattcttaggcccatctgcattgttgaatgcatatcgttttatc
atcgattctcgtgatacagcgactcaagatcgtttaagtcgtcttgatgacccattctca
ttgttccgttgtaaagggattatgaactgtgtgtctgtatgtcctaaaggtttgaaccca
acaaaagcaatcggtcatatccgtagcatgttgctcgaccaagctggttaa

DBGET integrated database retrieval system