KEGG   Acinetobacter wuhouensis: BEN71_13650Help
Entry
BEN71_13650       CDS       T05823                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
awu  Acinetobacter wuhouensis
Pathway
awu00020  Citrate cycle (TCA cycle)
awu00190  Oxidative phosphorylation
awu00650  Butanoate metabolism
awu01100  Metabolic pathways
awu01110  Biosynthesis of secondary metabolites
awu01120  Microbial metabolism in diverse environments
awu01130  Biosynthesis of antibiotics
awu01200  Carbon metabolism
Module
awu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
awu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
awu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:awu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BEN71_13650
   00650 Butanoate metabolism
    BEN71_13650
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BEN71_13650
Enzymes [BR:awu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BEN71_13650
    1.3.5.4  fumarate reductase (quinol)
     BEN71_13650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 GIDA HI0933_like FAD_binding_3 Pyr_redox_3 NAD_binding_8 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AXQ23057
UniProt: A0A385C5Q7
LinkDB All DBs
Position
complement(2713199..2715097)
Genome map
AA seq 632 aa AA seqDB search
MGAIIPKEDYTNIPHETFDAVIVGGGGSGMRASYQLAQAGLKVAVLTKVFPTRSHTVAAQ
GGIGASLGNMQEDNWHYHFYDTVKGSDWLGDQDAIEFMTREAPQVVYELEHLGMPFDRNA
DGTIYQRPFGGHAANYGEKPVPRACAAADRTGHALLHTLYQSNVKMGTQFFVEWIALDLI
RNEEGDVLGVTAIDQETGKIAVFQGKATLFATGGAGRVYRASTNAYINTGDGLGMAARAG
IPLQDMEFWQFHPTGVAGAGVLLTEGCRGEGAILRNKDGEPFMERYAPTLKDLAPRDFVS
RSMDQEIKEGRGCGPKGDYILLDMTHLGADTIMKRLPSVFEIGKKFANVDITKEAIPVVP
TIHYQMGGIPTNIHGQVVLPESAETQELVANYNKETGVYSHNGGERNFTKPVKGFYAIGE
CSCVSVHGANRLGTNSLLDLVVFGKAAGEHIIDYVTKHHGDEYTPLPTTVLVNTVNRIKH
LDDSTSGENAQEVADAIRDIVQDHAGVFRTQALLDEGVKQILAIEPRVRNIHLKDKSKVF
NTARIEALEVENLYEVAKATLISAAARKECRGAHTVVDYELPPDHADYPYGRRDDEWMKH
TLWFSTDNHLEYKPVRYNPLKVDPIPPKPRTF
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctataatccctaaagaagattacacaaatattccacacgaaactttcgatgca
gtcatcgttggtggtggtggttcaggtatgcgtgcttcttatcagcttgctcaagcaggt
ttgaaagttgctgtgctaaccaaagtattcccaactcgttctcatacagttgcggctcaa
ggtggtattggtgcatctcttggtaatatgcaagaagataactggcactatcacttctat
gacactgttaaaggttcagactggttaggtgaccaagacgcaatcgagtttatgactcgt
gaagcgcctcaagttgtttatgaacttgaacaccttggtatgccatttgaccgtaacgct
gacggtacaatttaccaacgtcctttcggtggtcatgctgcgaactatggtgaaaaacca
gttccacgtgcttgtgctgctgctgaccgtacaggtcacgcacttcttcacacgctttat
caaagcaacgtgaaaatgggtactcaattctttgttgaatggattgcattagatttaatc
cgtaatgaagaaggtgatgtgcttggtgtaactgcgattgaccaagaaacgggtaaaatt
gcagtattccaaggtaaagcaacattgtttgctactggtggtgcgggtcgtgtttaccgt
gcatctactaacgcatatatcaacactggtgacggtcttggtatggcggctcgtgcaggt
attccattacaagatatggaattctggcagttccaccctacaggtgtagcgggcgcaggc
gtattgttgactgaaggttgtcgtggtgaaggtgcaatccttcgtaacaaagacggcgaa
ccgttcatggaacgttatgcaccaactttgaaagatttggctccacgtgacttcgtatca
cgttctatggaccaagagatcaaagaaggtcgtggttgtggtcctaaaggtgattatatc
cttcttgatatgactcacttgggtgcggacacgatcatgaagcgtttaccatctgtattt
gagatcggtaaaaaattcgcgaacgttgacatcactaaagaagcgattcctgtagtacca
acaatccattatcaaatgggtggtattccaacgaatattcatggtcaagttgttcttcct
gaaagtgctgaaactcaagaacttgttgcgaactacaacaaagaaactggtgtgtattca
cacaatggtggtgaacgtaacttcactaaacctgtaaaaggtttctatgcaattggtgaa
tgttcttgcgtatctgtacatggtgcaaaccgtttaggtacgaactcacttcttgacttg
gttgtatttggtaaagctgcaggtgaacacatcattgattacgtgactaaacatcacggt
gatgagtacacaccattacctacaactgtgcttgtaaatacagtaaatcgtatcaaacac
cttgatgattcaacttcaggtgaaaatgcacaagaagtcgctgatgcaatccgtgacatc
gttcaagatcacgcgggtgtattccgtactcaagcattacttgacgaaggtgttaaacag
attcttgcaatcgaacctcgtgtacgtaacattcacttgaaagacaaatctaaagtattc
aacacagcacgtattgaagctttggaagttgaaaacttatacgaagtagcgaaagcaacc
ttgatttctgctgctgcacgtaaagaatgtcgtggtgcgcatacggttgtagattacgag
ttaccacctgatcatgcagattacccatatggtcgtcgtgatgatgagtggatgaaacac
acgttgtggttctctacagacaatcacttggaatataagccagtacgctataatccattg
aaagttgatccaattccacctaaaccacgtacattctaa

DBGET integrated database retrieval system