KEGG   Acinetobacter wuhouensis: BEN71_16215Help
Entry
BEN71_16215       CDS       T05823                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
awu  Acinetobacter wuhouensis
Pathway
awu00061  Fatty acid biosynthesis
awu00780  Biotin metabolism
awu01100  Metabolic pathways
awu01130  Biosynthesis of antibiotics
awu01212  Fatty acid metabolism
Module
awu_M00083  Fatty acid biosynthesis, elongation
awu_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:awu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BEN71_16215
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BEN71_16215
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BEN71_16215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:awu01004]
    BEN71_16215
Enzymes [BR:awu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BEN71_16215
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BEN71_16215
Lipid biosynthesis proteins [BR:awu01004]
 Fatty acid synthase
  Component type
   BEN71_16215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AXQ23519
UniProt: A0A385C7A2
LinkDB All DBs
Position
complement(3272791..3273594)
Genome map
AA seq 267 aa AA seqDB search
MAQGLLAGKRFLIAGIASKLSIAFGIAQALHREGAELAFTYPNDKLKKRVDEFAEQFGST
LVFPCDVAVDADIDNAFAELAKHWDGLDGVVHSIGFAPANTLDGDFTDVTDREGFKVAHD
ISAYSFVAMARAAKPLLLARQGCLLTLTYQGSESVMPNYNVMGMAKASLEAGVRYLASSL
GAEGIRVNAISAGPIRTLAASGIKSFRKMLDANEKIAPLKRNVTIEDVGNAALFLCSPWA
NGITGEILYVDAGFNTVGMSTSMMDAE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaggactattggcaggtaagcgttttttaattgcaggtattgcgagtaaatta
tcaattgcatttggtatcgctcaagcacttcaccgtgagggtgcagagcttgcatttaca
tatccaaatgacaaacttaaaaaacgtgtagatgagtttgctgaacaattcggctcaact
ttagtttttccttgtgatgttgctgtcgatgcagacattgacaatgcttttgctgaactt
gcaaaacattgggatggtttagatggtgtggttcactcgatcggatttgcacctgcaaat
acccttgacggtgactttactgatgtaactgatcgtgaaggctttaaagttgcacatgat
attagtgcttatagctttgttgcgatggcacgtgctgcaaaacctttgttattggctcgc
caaggttgcttattgaccctaacttatcaaggttctgagtctgtgatgccgaactacaat
gtgatgggtatggcaaaagcatctttggaagcgggtgtgcgttatttggcctctagcctt
ggtgccgaaggtattcgtgttaatgcaatctcagcaggcccaatccgtactttggcagct
tcaggcattaaatctttccgtaaaatgttagatgccaatgaaaaaattgcaccattaaaa
cgtaatgtgacgattgaagatgtaggtaatgctgcattgttcctttgctcaccttgggcg
aatgggattacaggtgaaattctttatgttgatgcaggctttaatactgtaggtatgagc
acatcaatgatggatgccgagtaa

DBGET integrated database retrieval system