KEGG   Acinetobacter wuhouensis: BEN71_17265Help
Entry
BEN71_17265       CDS       T05823                                 

Definition
(GenBank) PBP1A family penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
awu  Acinetobacter wuhouensis
Pathway
awu00550  Peptidoglycan biosynthesis
awu01100  Metabolic pathways
awu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:awu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BEN71_17265
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BEN71_17265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:awu01003]
    BEN71_17265
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:awu01011]
    BEN71_17265
Enzymes [BR:awu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BEN71_17265
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BEN71_17265
Glycosyltransferases [BR:awu01003]
 Polysaccharide
  Bacterial polysaccharide
   BEN71_17265
Peptidoglycan biosynthesis and degradation proteins [BR:awu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BEN71_17265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB Parvo_NS1
Motif
Other DBs
NCBI-ProteinID: AXQ23712
UniProt: A0A385CA27
LinkDB All DBs
Position
3473430..3475985
Genome map
AA seq 851 aa AA seqDB search
MKKLSCSGHIHPFFLLIIIILVAIPMGFYGMYLYIAPSLPEMSSLKKAPLLKPLQVYSAD
NQLIAEYGGKLSVPVEYNQIPPHFIHAFLAAEDSSFFEHSGISFKGLGRAVSETVTGSNV
QTGGSTITMQVAKNYYLSPERTLKRKLTEVFLARKIEQNLSKEDILSLYVNKIFLGKNAY
GIAAAAKIYYDKNLDQLSVAQMAMIAGLPKAPSKYNPVVNPERALERRNWILGRMLQLGY
LKQNEYQKAVAEPINLSMPDRGLSNKFPYVGEMVRSELVEKFGDQAVDSGYKVYTTINSQ
RQQYAEESVQKGLEDYDRRHGWRGAEAHDKPLKEFIAYANTFPAEVIKVNSNSFEAKMQD
GSTVTVPWSGMSWARKYINANAVGGAPSRASQIVSTKDIVRLRPNENKTAWSLVQVPKAQ
GQLIAINPNDGSIVAIVGGYNFYHSKFNRALQGWRQPGSTIKPFIYALALERGMTPYTMV
NDNPISIGRWSPKNSDGRYLGMIPLRRALYLSRNTVSVRLLQSVGVERARQLLMDFGLQE
DQIPRNFTIALGTPQVLPVQMATGYATIANGGYRIQPHFISRIEDAYGKVIYEANPDYAC
IPCINQKEQTVKTEDAEVTTDDEVIAGNTNTDDVQPILTKEEQSKYRQAQRILKSQSAFD
MANILRDVIVHGTGRAALKIGRDDIGGKTGTTNDAKDAWFAGFNGKLVAIAWVGFDQPST
LGRREYGGIAALPVWTSFMGKALKGTPSAWVHFDKDAKAPLSREQRGQQTQVEGQSNEAS
KESGSTPPLARPIYKPAPVTPSRNASNDFDDLPDENGEQKLKPTTSTPPTMNQDHAKREN
DSLENLINEVQ
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctatcttgttcaggtcatattcatcccttttttttgctgattattattatc
ttagtcgcaattccgatgggcttttatggaatgtacctatatatcgccccatcgttacca
gaaatgagctctttaaaaaaggcgccattgcttaaacctttgcaagtttattctgcagat
aatcaactgattgctgaatatggtggcaaactttctgtgcccgttgagtacaatcagatt
ccaccacatttcatccatgcctttctagcggctgaagactcctccttttttgaacacagt
gggatcagctttaagggtttaggacgcgcagtcagtgaaactgtgacaggctcaaatgtg
caaacaggtggttcaaccatcaccatgcaagtggcaaaaaactattatttatctcctgaa
cgtactttaaaacgaaaattaaccgaagtatttttggcacgaaaaatagaacaaaactta
tcaaaagaagatattttatcgttatacgtcaataaaatatttttaggtaaaaatgcctat
ggtattgctgctgctgcaaaaatttattatgacaaaaaccttgatcaactcagtgttgct
caaatggcgatgatcgcgggtctacctaaagcgccatcaaaatacaatccagtagtcaat
cctgaacgtgctttagaacgtcgtaattggattctaggtcgtatgttacagctcgggtat
ttaaaacaaaatgaatatcaaaaagcagtcgctgaaccaatcaatctcagtatgcctgac
cgtggactcagcaataaatttccctatgtaggcgaaatggttcgttcagagttggttgag
aaatttggcgatcaagctgttgattctggttataaagtttatacaacaatcaatagccaa
cgtcagcaatatgcagaagaatctgtacaaaaaggattagaggattatgaccgtcgtcat
ggttggcgtggtgcagaagcccatgataaacctttaaaagagtttatagcctatgctaat
actttccctgccgaagtaataaaagtaaatagcaactcctttgaagcaaagatgcaagat
ggttcaacagtcactgtgccatggtctggaatgtcatgggcaagaaaatatattaatgcc
aatgctgttggtggtgcgccaagtcgtgcttctcaaattgtcagcaccaaagatattgtg
cgcttacgcccaaatgaaaataaaacagcatggtcattggtacaagtccctaaagcacag
ggacagctcattgcaatcaatcctaatgatggttcgattgtagccatcgtgggtgggtat
aacttctatcactctaaatttaaccgtgccttgcagggttggcgccaacccggttcgacc
atcaagcctttcatttatgcactcgcacttgaacgaggtatgactccttatacaatggtc
aatgataatccgatcagtattggcagatggtcacctaaaaactcggatggacgctactta
ggaatgattcccttgcgtcgtgcattatacctctctcgtaataccgtttctgtacgctta
ttacaaagtgttggcgtggaacgcgctcgtcaattattgatggattttggcttacaagaa
gaccaaattccacgcaacttcaccattgcactcggtacaccacaagtacttcctgtgcaa
atggcaacaggttatgccaccattgccaatggtggttatcgtattcaaccacactttatc
agtcgtatcgaagatgcctatggcaaagtcatttacgaagcaaatcctgactatgcctgt
atcccatgtatcaatcaaaaagagcaaactgtaaaaacagaagatgcagaagtcactact
gacgatgaagtgattgcaggtaataccaatacggatgatgtacaacctattttaacaaaa
gaagagcaaagtaaatatcgccaagctcaacgtattttaaaatcacaatccgcttttgat
atggcgaatatccttcgtgacgttatcgtacatggtactggacgtgccgcattgaaaatt
ggtcgtgatgatattggtggtaaaacaggaacaaccaatgatgcaaaagatgcatggttt
gctggttttaatggaaaattagtggcgatcgcatgggtcggttttgaccaaccttcaacc
ttaggtcgtcgtgaatatggtggtattgccgcacttccagtatggaccagctttatgggt
aaagcgctaaaaggcacaccttcggcgtgggttcattttgataaagatgctaaggcacca
ctttcacgtgagcaacgtgggcaacaaacccaagttgaagggcaaagtaatgaagcaagt
aaagaaagtggctcaactccacctttagctcgtcctatttacaaacctgctcctgtgaca
ccatcacgtaatgcttcaaatgactttgatgacctacctgacgagaatggcgaacaaaaa
ctaaaaccaaccacttcaacgcctccgaccatgaatcaagatcatgcaaaacgtgaaaac
gactctctagagaacttaatcaatgaagttcaatag

DBGET integrated database retrieval system