KEGG   Acinetobacter wuhouensis: BEN71_17290Help
Entry
BEN71_17290       CDS       T05823                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
awu  Acinetobacter wuhouensis
Pathway
awu00550  Peptidoglycan biosynthesis
awu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:awu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BEN71_17290
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BEN71_17290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:awu01011]
    BEN71_17290
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:awu03036]
    BEN71_17290
Enzymes [BR:awu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BEN71_17290
Peptidoglycan biosynthesis and degradation proteins [BR:awu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BEN71_17290
Chromosome and associated proteins [BR:awu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BEN71_17290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AXQ23717
UniProt: A0A385C7M5
LinkDB All DBs
Position
complement(3480962..3482797)
Genome map
AA seq 611 aa AA seqDB search
MVDKQTKQTRQSRKKQPSISGKNPISLDMWRFYLMWGVVLLCFVGLIGRAFYVQVINKDF
LQNKANANILRSEKLKAMRGVISDRHGVPLAISSPIMKVVIDPREYFETKAQFEKITEEL
KKTPNSRKLKRQLPDENLNLDELADVVGIDRADLKKRLYERPRSRYLVLKKEVPPPQADF
LTEHKFAGVYAEKTYKRYYPQPQPNAQIIGLTNSEGTGIEGLEMQLNTRLAGEDGEQKIS
RDKHGNRINTPEVVKEVKAGENITLSIDSRLQYIMYRELTAVGVANSARSASSIAVDVKT
GEILAMASWPSYNPNDKNGLSNKDAMRNRGAIDMFEPGSTMKPFTIAAGLESGKYTPNSI
ISTAPGTMRLGSHTIRDTHNYGALTVTGVIIKSSNIGSAKIALSLPKETLPTFFRRVGFG
QRSAVKFPGESGGLVVSPEKLNPSQIGTMAYGYGLNATILQLAQGYAMLANHGVEYPLSL
YKLNDQPKGKQVLAPKIADDVLLMLEQVTMPGGTAKQANIPGYRVGGKTGTAHKLRPDHK
GYSSTEYRALFAGVAPISDPRLAIIVVVENPRGQYYGGLVAAPVFAKIMQESLRLMNVPL
DKPLETAKASK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacaaactaaacagactcggcaatcacgtaaaaaacagccgtctatctca
gggaaaaatccaatatctttagatatgtggcgtttttatttgatgtggggcgtagtattg
ctatgctttgtagggctgattggtcgtgcattttatgtgcaagtgattaataaagacttt
ttacaaaataaagccaatgccaatattttacgttctgaaaaattaaaagcgatgcgtggc
gtgattagtgatcgtcatggtgtgcctttggcgattagttctccgattatgaaagtggtg
atcgatccgcgtgaatactttgagaccaaagcgcaatttgaaaaaattactgaagaatta
aagaaaacgccaaacagtcgtaaacttaaacgacagttgccagatgaaaatttaaattta
gatgaattggctgatgtcgttggtattgatcgtgcagatttgaaaaagcgtttgtatgag
cgtccgcgttcacgttatttagtcttgaaaaaagaagtaccaccaccgcaagctgatttt
ttaacagaacataagtttgctggcgtttatgcagaaaaaacctataagcgctattatccg
caacctcaacccaatgcacagattattggcttgaccaatagtgaaggcactgggattgaa
ggtttagaaatgcagttgaacacacgtcttgcaggtgaagatggtgagcaaaagatttcg
cgggataagcatggtaaccgtattaatacgcctgaagtggtaaaagaagtaaaagcgggg
gagaacattacattaagtatcgattctcgtctgcaatatattatgtatcgtgaattaacc
gctgttggtgtggcgaatagtgcgcgttcagcatcttcaattgctgttgatgtgaaaacg
ggtgagattctggcaatggcgagttggccatcttataacccaaatgataagaacggtttg
agcaataaggatgccatgcgtaaccgtggggcaattgatatgtttgaaccaggttcaacc
atgaagccatttacaattgctgctggtttagaaagtggaaaatacacaccaaattcgatc
attagtaccgcaccaggcacaatgcgtttaggttcgcatactattcgtgatacccataat
tatggtgcattaacagtcacaggtgtgattattaagtcttcgaacattggctcagcgaaa
atcgctttgtcattgccaaaagaaacattacctactttctttagacgagttggttttggt
caacgttcggctgtgaaattccctggtgaaagtggtggtttggtagtttcacctgaaaaa
ctgaatccttctcaaattggaactatggcttatggttatggtttgaacgcaaccatttta
cagttggctcaaggttatgccatgttggcgaatcatggtgttgaatatcctctaagcctt
tataagttgaatgatcaaccgaaaggcaagcaggtattggcacctaaaattgcagatgat
gtcttgttgatgttagagcaagtcaccatgccaggcggtacagcaaaacaagccaatatc
ccaggctatcgcgtaggtggtaaaacaggaacagcacataaacttcgccctgaccataaa
ggctattcgagtactgaataccgtgctttgtttgcaggtgtcgcgccgattagtgatcca
cgcttagcgattattgttgtggtggaaaatccacgtgggcaatactacggtggtttagtt
gccgcaccagtcttcgcaaaaattatgcaagaatctttacgtttaatgaacgtaccttta
gacaaaccgcttgaaacagcgaaagcatccaaatag

DBGET integrated database retrieval system