KEGG   Alcanivorax xenomutans: P40_07025Help
Entry
P40_07025         CDS       T04770                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
axe  Alcanivorax xenomutans
Pathway
axe00071  Fatty acid degradation
axe00280  Valine, leucine and isoleucine degradation
axe00281  Geraniol degradation
axe00310  Lysine degradation
axe00362  Benzoate degradation
axe00380  Tryptophan metabolism
axe00410  beta-Alanine metabolism
axe00640  Propanoate metabolism
axe00650  Butanoate metabolism
axe00903  Limonene and pinene degradation
axe00930  Caprolactam degradation
axe01100  Metabolic pathways
axe01110  Biosynthesis of secondary metabolites
axe01120  Microbial metabolism in diverse environments
axe01130  Biosynthesis of antibiotics
axe01200  Carbon metabolism
axe01212  Fatty acid metabolism
Module
axe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:axe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    P40_07025 (fadB)
   00650 Butanoate metabolism
    P40_07025 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    P40_07025 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P40_07025 (fadB)
   00310 Lysine degradation
    P40_07025 (fadB)
   00380 Tryptophan metabolism
    P40_07025 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    P40_07025 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    P40_07025 (fadB)
   00281 Geraniol degradation
    P40_07025 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P40_07025 (fadB)
   00930 Caprolactam degradation
    P40_07025 (fadB)
Enzymes [BR:axe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     P40_07025 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     P40_07025 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     P40_07025 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     P40_07025 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 SDH_sah
Motif
Other DBs
NCBI-ProteinID: ARB45212
LinkDB All DBs
Position
complement(1499693..1501840)
Genome map
AA seq 715 aa AA seqDB search
MIYQGNAVSVQLLDDGIAELKFDLQGESVNKFNRATLEDFQKAIDAIKGSDQIKGLIVTS
GKKVFIVGADITEFTEMFAQEEAEIAKWSREANNIFSAFEDLDIPKVVAINGFAMGGGLE
MCLVCDFRVMSEQAQIGLPEVKLGIFPAFGGTVRMPRLVGVDNAVEWIATGAQQKPEKAL
KDGVVDAVVKHDDLHNAAIDLVKQCLAGKIDFRAKRQEKLEPLKLPPMENMMAFQTCTAM
VMQQAGKNYPAPVEAVKVMQKAAGMKREEALDVEAQGFAKVAKTPQATALVGLFLADQQV
KKVNGKVAKTAKDIQQAAVLGAGIMGGGIAFQSALKGTPIIMKDIADKALDLGMNEASKL
LAKRVAKGKMDAAKMGKVLSSIRPTLNYGDFENVNVIVEAVVENTKVKQAVLAEVEEKVA
DGTILASNTSTISITKLAEALKKPENFGGMHFFNPVHMMPLVEVIRGEKTSDETIATLVA
YAQKMGKNPIVVNDCPGFLVNRVLFPYFAGFGMLVRDGADFQQVDKVMQKFGWPMGPAYL
LDVVGIDTGVHAAKVMAEGFPDRMQHDFKDPTEIMFENERYGQKNGIGFYRYEQDKKGKP
KKVADEGSYELLKPIAAERKEFDAEEIIARMMIPMCTETVRCLEDNIVGSAAEADMAMIY
GIGFPPFRGGPLRYIDSIGTKAFADLCDKYAHLGALYEAPQMLKDKAAKGESFFA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatctatcaaggcaacgccgtaagcgtacaactgcttgacgacggcatcgccgagctg
aagttcgaccttcagggcgagtccgtcaacaagttcaaccgggccaccctggaagacttc
cagaaagccatcgacgccatcaagggcagtgaccagatcaagggtctgatcgtcacctcc
ggcaagaaggtgttcatcgttggcgcggacatcactgaattcaccgaaatgttcgcccag
gaagaagcggagatcgccaaatggtcccgcgaggccaacaacatcttcagcgccttcgag
gatctggacattcccaaggtggtcgcgatcaacggcttcgccatgggcggcggcctggaa
atgtgcctggtgtgcgacttccgggtgatgagcgaacaggcgcagatcggcctgccggaa
gtgaaactcggcatcttcccggccttcggcggcaccgtgcgcatgccgcgcctggtgggc
gtggacaacgccgttgagtggatcgccaccggcgcccagcagaaaccggaaaaagccctg
aaggacggcgtggtggacgcggtggtcaagcacgacgacctgcacaacgccgccatcgat
ctggtcaagcaatgcctggccggcaagatcgacttccgcgccaagcgccaggaaaaactg
gagccgctgaagctgccgccgatggaaaacatgatggcgttccagacctgcaccgccatg
gtcatgcagcaggccggcaagaactacccggcgccggtggaagccgtgaaggtgatgcag
aaagccgccggcatgaagcgcgaggaagcactggacgtggaagcccagggcttcgccaaa
gtggccaagaccccgcaagccaccgccctggtgggcctgttcctggccgaccagcaagtg
aagaaggtcaacggcaaggtcgccaagaccgccaaggacatccagcaggccgcggtactg
ggcgccggcatcatgggcggcggcatcgccttccagtccgccctcaaaggcaccccgatc
atcatgaaggacatcgccgacaaggcgctggacctgggcatgaacgaagcctccaagctg
ctcgccaagcgcgtcgccaaaggcaagatggacgccgccaagatgggcaaggtgctctcc
tccattcgcccgaccctcaactacggcgactttgaaaacgttaacgtgatcgtcgaagcc
gtggtggaaaacaccaaggtgaaacaagccgtgctggcggaagtggaagagaaagtggcg
gacggcaccattctggcctccaacacctccaccatctccatcaccaagctggcggaagcg
ctgaaaaaaccggaaaacttcggcggcatgcacttcttcaacccggtgcacatgatgccc
ctggtggaagtgatccgtggtgagaaaacctccgacgaaaccatcgccaccctggtcgcc
tacgcccagaaaatgggcaaaaatccgatcgtggtcaacgactgccccgggttcctggtg
aaccgcgtgctgttcccgtacttcgccggcttcggcatgctggtacgcgacggcgccgac
ttccagcaagtggataaagtgatgcagaaattcggctggcccatgggcccggcctacctg
ctcgacgtggtcggcatcgacaccggcgtgcacgccgccaaagtgatggcggaaggcttc
ccggaccgcatgcagcacgacttcaaggaccccaccgaaatcatgttcgagaacgagcgc
tacggccagaagaacggcattggcttctaccgttacgagcaggacaagaagggcaaaccg
aagaaagtggccgacgaaggcagctacgagctgctcaagccgatcgccgccgagcgcaag
gaattcgacgccgaggagatcatcgcccgcatgatgatcccgatgtgcaccgaaaccgtc
cgctgtctggaagacaacatcgtcggctccgccgccgaagcggacatggcgatgatctac
ggcatcggcttcccgccgttccgtggcggaccgctgcgctacatcgacagcatcggcacc
aaggcattcgccgacctgtgcgacaagtacgcacacctgggcgccctttatgaagcgccg
caaatgctcaaggacaaggccgccaagggcgagtccttcttcgcgtaa

DBGET integrated database retrieval system