KEGG   Alcanivorax xenomutans: P40_09210Help
Entry
P40_09210         CDS       T04770                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
axe  Alcanivorax xenomutans
Pathway
axe00061  Fatty acid biosynthesis
axe00780  Biotin metabolism
axe01100  Metabolic pathways
axe01212  Fatty acid metabolism
Module
axe_M00083  Fatty acid biosynthesis, elongation
axe_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:axe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    P40_09210
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    P40_09210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:axe01004]
    P40_09210
Enzymes [BR:axe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     P40_09210
Lipid biosynthesis proteins [BR:axe01004]
 Fatty acid synthase
  Component type
   P40_09210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT
Motif
Other DBs
NCBI-ProteinID: ARB45574
LinkDB All DBs
Position
1984869..1985306
Genome map
AA seq 145 aa AA seqDB search
MMDINEVREYLPHRYPFLLVDRVVNVEPGKRIEAYKNVTINEPFFNGHFPQEPIMPGVLI
IEAMAQAAGILGFVTENKRPADGYIYLLVGVDNARFKRQVVPGDRLTLHAEWLMLRRSIL
KFTCRAEVEGQLVASADMLVAEQKV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatggacattaacgaggtgcgggaatacttgccccaccgctatccgtttttgctggtg
gaccgggtggtgaacgtggagccgggcaagcgcatcgaggcgtacaagaacgtcacgatc
aacgagcccttcttcaacggccatttcccgcaggaaccgatcatgcccggcgtgctgatc
atcgaagcgatggctcaggccgccgggatcctcgggttcgttaccgagaacaagcgcccg
gcggatggttacatctacctgctggtgggcgtggacaatgcccgtttcaagcgtcaggtc
gtgcccggtgatcgtttgacgctgcatgccgagtggctgatgctgcgccgcagcatcctc
aagttcacctgccgcgcggaagtggagggccaactggtggcctccgccgacatgctggtg
gcggaacagaaagtctga

DBGET integrated database retrieval system