KEGG   Alcanivorax xenomutans: P40_11820Help
Entry
P40_11820         CDS       T04770                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
axe  Alcanivorax xenomutans
Pathway
axe00020  Citrate cycle (TCA cycle)
axe00270  Cysteine and methionine metabolism
axe00620  Pyruvate metabolism
axe00630  Glyoxylate and dicarboxylate metabolism
axe00680  Methane metabolism
axe01100  Metabolic pathways
axe01110  Biosynthesis of secondary metabolites
axe01120  Microbial metabolism in diverse environments
axe01130  Biosynthesis of antibiotics
axe01200  Carbon metabolism
Module
axe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
axe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
axe_M00012  Glyoxylate cycle
axe_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:axe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P40_11820
   00620 Pyruvate metabolism
    P40_11820
   00630 Glyoxylate and dicarboxylate metabolism
    P40_11820
  09102 Energy metabolism
   00680 Methane metabolism
    P40_11820
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    P40_11820
Enzymes [BR:axe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     P40_11820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: ARB46009
UniProt: A0A1V0FKT0
LinkDB All DBs
Position
2563910..2564890
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQISYSLLFRIASGDMLGKDQPVILQLLEITPALEALKGVVMELEDC
AFPLVAGIVQTDDANVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQGKAINDNA
SKGIKVLVVGNPANTNALIAQRNAPDIDPRQFTAMTRLDHNRAMAQLANKLGKTVNDVKK
MTIWGNHSSTQYPDLHHCEVDGKVAIDQIEQDWYEADYIPTVQQRGAAIIKARGASSAAS
AANAAIDHMRSWALGTDEGDWVSMGIYSDGSYGIQEGLIYSFPCTCKDGDWSIVQGLENN
EFSKAKMQATEQELAEERDAVSHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacctgtacgcgtggcggtgactggcgccgctggccaaatcagctactccctg
ctgttccgcatcgcttccggcgacatgctcggcaaggatcagccggtaatcctgcaactg
ctggaaatcacccccgctctggaagccctgaaaggggtggtgatggaactggaagactgc
gccttcccgctggtggccggtatcgtgcaaaccgacgacgccaatgtggccttcaaggac
gccgactacgccctgctggtaggtgcccgtccccgtggcccgggcatggagcgtaaggac
ctgctggaagccaacgcggcgatcttctccgcccaaggcaaagccatcaacgacaacgcc
agcaaaggtatcaaagtgctggtggtgggtaacccggccaacaccaacgctctgatcgcc
cagcgtaacgcgccggacatcgacccgcgtcagttcaccgccatgacccgtctggaccac
aaccgcgccatggcgcagctggccaacaaactgggcaagaccgtcaacgacgtgaagaag
atgaccatctggggcaaccactcctccacccagtacccggatctgcatcactgcgaagtg
gacggtaaagtggccatcgatcagatcgagcaggactggtacgaagcggactacatcccc
accgtgcagcagcgtggcgccgccatcatcaaggcccggggtgcctcctccgccgcttcc
gccgccaacgccgccatcgaccacatgcgctcctgggcgctgggcaccgatgaaggcgac
tgggtttccatggggatctacagcgacggttcctatggtatccaggaaggcctgatctac
tccttcccctgcacctgcaaggatggcgactggagcatcgtccagggcctggaaaacaac
gagttctccaaagccaagatgcaggccaccgagcaggaactggccgaagagcgcgacgcg
gtaagccacctgctgccgtaa

DBGET integrated database retrieval system