KEGG   Alcanivorax xenomutans: P40_15330
Entry
P40_15330         CDS       T04770                                 

Definition
(GenBank) ATPase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
axe  Alcanivorax xenomutans
Pathway
axe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:axe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    P40_15330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:axe01001]
    P40_15330
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:axe02022]
    P40_15330
Enzymes [BR:axe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     P40_15330
Protein kinases [BR:axe01001]
 Histidine kinases
  OmpR family
   P40_15330
Two-component system [BR:axe02022]
 OmpR family
  RstB-RstA
   P40_15330
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3 HATPase_c_5
Other DBs
NCBI-ProteinID: ARB46610
LinkDB
Position
complement(3365906..3367519)
AA seq 537 aa
MNSIFVRIYGGILVALLIIGAATYVGVDLINQYRAGQYRERMAEGTFFLLGEGLREQSGA
DRAEWLREMSRRLGASLRIHPGADLSLTYRERLHLDEGRVVIREHRESERITVLYHVPGG
DDYLVTSLERLSEQQARATAGLILDRLKAVAPEQRAQSLARLVPYFGFPLSLAEWGEVGL
DEEQYQRLDRNEMVLLLTDSTRRDATLYLYVPIPRDHRVLVLGPMTLFDPFPWELLVIAS
LLALCLVALSTYLQVRPLQTRLRHLERAVKRLGGGDLTAHADVRGGDSIGQLAATFNGMT
AHIRRLIHAQREMTRAVSHELRTPVARLRFGLEMLADSESAEARRERLDALDRDIDQLDQ
LIDEILTYARLEQGTPTIDFQPVYLVEVCEQLRGELDTIRGDIVIEVEGDRTLAVDGDPR
YLHRILQNLVTNALRYAQARIRMTIRLEEDGERVVLDVDDDGSGIPEHQRERVFKPFARL
DQSRHRASGGYGLGLSIVKRIVDWHGGEVRVLESDWGGARFQVILPREQQRQHVLGR
NT seq 1614 nt   +upstreamnt  +downstreamnt
ttgaacagcatttttgtgcgcatctacggtggcatcctggtggccttgctgatcatcggt
gccgccacttatgtcggcgttgatctgatcaatcagtaccgtgccggtcagtaccgcgag
cgcatggcggaggggactttctttctgctcggggaggggctgcgggagcagtccggagcc
gaccgtgccgaatggttgcgggaaatgagccgccggcttggcgcgtccctgcggatacac
ccgggggcggacctcagcctgacctaccgggagcggttgcacctggacgaaggccgggtg
gtgatccgcgaacaccgggagtccgaacggatcaccgtgctgtatcacgttcccggcggc
gacgattatctggttaccagtctcgaacgtctctccgagcagcaggcgcgcgccaccgcc
ggtctgatcctggatcgcctcaaggcggtggcgccggagcagcgggcccagtccctggcg
cggctggtgccgtacttcgggtttccgctgtccctggcggagtggggagaagttggtctg
gacgaggaacagtaccagcgcctggaccgcaacgagatggtgctgctgctcaccgacagc
acgcgccgggacgccaccctctacctttacgtgcccatcccacgggaccaccgggtgctg
gtgctcgggccgatgaccctgttcgatccgttcccctgggaattactggtgatcgccagc
ttgctggccttgtgtctggtggcgttgtccacttatctccaggtccggccgctgcaaacc
cggctgcgtcatctcgagcgggcggtgaaacggctcggcggcggcgatcttaccgcccac
gccgacgttcgcggcggcgactccatcggccagctggccgccaccttcaacggcatgacc
gcccacatccgccggttgatccatgcccaacgggagatgacccgggcggtctcccacgaa
ctgcgcacgccggtggcgcggctgcgtttcggtctggaaatgctggccgacagcgaatcc
gccgaggcccgccgggagcgactggatgccctggaccgggacattgaccagctggatcag
ttgatcgatgagattctcacctatgcgcggctggaacagggcacgccgaccatcgacttc
cagccggtgtatctggtggaagtgtgcgagcagttgcgaggggaactggacacgattcgc
ggggatatcgtgatcgaggtggaaggggaccggaccctggccgtggatggcgacccgcgc
tacctgcaccgtatcctgcagaatctggtcaccaacgctttgcgctacgcgcaggcgcgc
attcgcatgaccatacgcctggaagaagacggtgaacgggtggtgctggacgtggacgac
gacggttcggggatcccggaacatcaacgtgagcgggtgttcaaacccttcgcccgcctg
gaccaatcccgccatcgtgccagcggcggctacggcctggggctgtccatcgtcaagcgt
attgtcgactggcacggcggcgaagtgagggtgctggaaagcgactggggcggcgcccgt
ttccaggttatcctgccccgcgaacagcagcgccagcatgtgctgggaagataa

DBGET integrated database retrieval system