KEGG   Alcanivorax xenomutans: P40_18930Help
Entry
P40_18930         CDS       T04770                                 

Definition
(GenBank) hypothetical protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
axe  Alcanivorax xenomutans
Pathway
axe00330  Arginine and proline metabolism
axe00360  Phenylalanine metabolism
axe00380  Tryptophan metabolism
axe00627  Aminobenzoate degradation
axe00643  Styrene degradation
axe01100  Metabolic pathways
axe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:axe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    P40_18930
   00360 Phenylalanine metabolism
    P40_18930
   00380 Tryptophan metabolism
    P40_18930
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    P40_18930
   00643 Styrene degradation
    P40_18930
Enzymes [BR:axe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     P40_18930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ARB48078
LinkDB All DBs
Position
4115386..4116555
Genome map
AA seq 389 aa AA seqDB search
MILENGFLYFDPVHLDATGEGPLQGLTFAIKDVFDIAGTVTGIGQPSWRASQPPARHTSP
MIETLLAAGAELVGKTHTDELTYSLAGQNAHYGTPPNPAVPGAVPGGSSSGSASVVAAAL
VDFALGSDTGGSVRVPASYCGIHGLRPTHGVVDYRHCAHLAESFDTLGWFARDARLMARI
GQILLPASDRPVPRRLLLVEEALAQSDADVVSQLEARVGNGLPGVTFGGSISVGNLDTYF
SAFRPLQAYEAWARFGSWIEAEQPVFGPGVKERFEAASRITATEAEDAREQCQALRTRIR
ALLGEDTLLCLPTTPTSALPLQADQARVEDIRGRTLRMTALAGTTGLPQLSLPLLHDRDG
PVGLSLIGPAGSDQQLLDLAARLPEFINT
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgatactggaaaacggctttctctatttcgacccggtgcacctcgacgccaccggagag
ggcccgctgcagggcctgaccttcgccatcaaggacgtgttcgacatagccggcaccgtt
accggcatcggccagccgagctggcgcgccagccagccgccagcgcgacacacctctccg
atgatcgagaccctgctggcggcgggcgcggaactggtcggcaagacccacaccgacgag
ctgacttacagcctggcgggtcagaacgcgcactatggcacgccacccaatccggcggtg
ccgggcgcggtgccgggcggctcctccagcggctccgcctcggtggtggccgccgcgctg
gtggacttcgcgctgggcagcgacaccggcggttcggtgcgggtgcccgccagctactgc
ggcatccatggcctgcgtcccacccatggcgtggtggactaccgtcactgcgcccacctg
gcggaaagtttcgatacccttggctggttcgcccgggacgcccggctcatggcccgcatt
ggccagattttgctgcccgccagcgaccggccggtaccgcgccgtttgctgctggtggag
gaggcactggcgcaatccgatgccgacgtggtgtcgcaactggaagcgcgggtcggcaat
ggcctgcccggagtgacctttggcggcagcatcagtgttggcaacctggacacctacttc
agcgcgttccggccactgcaagcttacgaggcctgggcccgcttcggctcctggatcgaa
gccgagcaaccggtattcggccccggcgtgaaggagcgcttcgaggcagcgtcccgcatc
actgccaccgaagccgaggacgctcgtgaacaatgccaggctttgcggacccggatccgc
gccctgctcggcgaggataccctgctttgcctgcccaccacgccgacctcggccctgcct
ttgcaagccgaccaggccagggtggaagacatccgcggccgcaccctgcggatgacggcc
ctggccggcaccaccgggctgccgcaactgagtttgccgctgttgcatgaccgtgatggc
ccggtgggcctgtcattgatcggcccggcgggcagcgatcagcagctgctggatctggcg
gcccgcctgcctgaattcatcaatacctga

DBGET integrated database retrieval system