KEGG   Alcanivorax xenomutans: P40_19930Help
Entry
P40_19930         CDS       T04770                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
axe  Alcanivorax xenomutans
Brite
KEGG Orthology (KO) [BR:axe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    P40_19930
Enzymes [BR:axe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     P40_19930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored Glutaredoxin Thi4 FAD_binding_3 AlaDh_PNT_C K_oxygenase NAD_binding_8 FMO-like Cytochrom_C_2
Motif
Other DBs
NCBI-ProteinID: ARB47393
LinkDB All DBs
Position
complement(4339920..4341491)
Genome map
AA seq 523 aa AA seqDB search
MLDANLKTQLQSYMERITQPFEMVASLDDGDKSRELSELLRDIEAMSDKITLREDGDDER
RPSFSLNRVEGDISLRFAGIPMGHEFTSLVLALLQVGGHPPKVSDEVIEQVQALQGDFRF
ETYFSLSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQDEVDQRQVMAVPSVFLNGEEF
GQGRMGLEEILAKLDTGAAERDAEKLNAKDAFDVLVVGGGPAGAASAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPKLATALEQHVREYDVDIMNLQRAEQLIPADSEGG
LHEVRFASGASLKTKTLILATGARWREVNVPGEKEYRGRGVAYCPHCDGPLFKGKSVAVI
GGGNSGVEAAIDLAGIVEHVTLLEFDTKLRADAVLQKKLHSLANVTVHVNAQTTEITGDG
TKVNGLLYKDRDSGEEHRVELAGVFVQIGLVPNTDWLKGTVELSRHGEIITDARGETSVP
GIYAAGDVTTVPYKQIVIAMGEGAKAALSAFDHLIRTSVSDAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaacctgaaaacccaattgcaatcctacatggagcgcatcacgcaaccg
ttcgaaatggtcgcgtccctggatgatggcgacaaatccagggagctgtcggagctgctg
cgcgacatcgaggcgatgtccgacaagatcacgttgcgtgaggatggtgatgacgagcgc
cggccctcattcagcctgaatcgtgtggagggtgacatcagcctgcgcttcgccggtatc
cccatgggccatgaattcacctctctggtgctggcgctgttgcaagtgggtggtcatccg
cccaaggtcagcgacgaggtgatcgagcaagtgcaagcgctgcaaggcgacttccgcttc
gaaacctatttctctctgtcctgccagaactgcccggacgtggtccaggcgttgaacctg
atggcggtactgaacccgaacatcaaacacgtggccatcgacggcgccctgttccaggac
gaagtcgatcagcgccaggtgatggcggtacccagtgtgttcctgaacggcgaggaattc
ggccagggccgcatggggctggaggaaatcctcgccaaactggacaccggcgccgccgag
cgtgatgccgagaaactgaacgccaaggacgccttcgatgtgctggtggtgggcggtgga
cccgccggtgccgccagtgccatctacgccgcccgtaaaggcatccgcaccggtgtcgcc
gccgagcgctttggtggtcaggtgctggataccatggccatcgagaacttcatttcggtg
aaggaaaccgaggggccgaaactggccaccgcgttggagcagcacgtccgtgaatacgac
gtggacatcatgaatctgcagcgcgcggaacagctgattccggcggacagcgaaggcggc
ttgcatgaagtccgtttcgcctccggtgccagcctcaaaacgaagacgctgattctggcc
actggcgcccgctggcgtgaagtgaacgtgcccggtgagaaagagtaccggggacgcggc
gtggcctactgcccgcactgcgacggtccgctgttcaaaggcaagagcgtggcggtgatc
ggcggcggtaactccggcgtggaagcggccatcgacctggccggcatcgtcgagcacgtt
actctgctggagttcgacaccaagctgcgcgccgatgccgtgctgcagaagaaactgcac
agcctggccaacgtcaccgtgcacgtgaacgcccagaccaccgagatcaccggtgatggc
accaaagtgaacgggctgctgtacaaggatcgcgacagtggcgaagagcaccgcgtggaa
ctggccggggtgttcgtgcagatcggcctggtgcccaacaccgactggctgaaaggcacg
gtggagctgtcccgccacggcgagatcatcaccgacgcccgcggcgagacgtccgtcccc
ggcatctacgccgccggcgacgtcaccacggtgccgtacaagcagatcgtcatcgccatg
ggcgaaggggccaaggccgcgctgagcgccttcgaccacctgatccgcacctcggtgagt
gacgccgcctga

DBGET integrated database retrieval system