KEGG   Amphibacillus xylanus: AXY_03120
Entry
AXY_03120         CDS       T02266                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
axl  Amphibacillus xylanus
Pathway
axl00473  D-Alanine metabolism
axl00550  Peptidoglycan biosynthesis
axl01100  Metabolic pathways
axl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:axl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AXY_03120 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AXY_03120 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AXY_03120 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:axl01011]
    AXY_03120 (ddl)
Enzymes [BR:axl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AXY_03120 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:axl01011]
 Precursor biosynthesis
  Amino acid ligase
   AXY_03120 (ddl)
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A RimK
Other DBs
NCBI-ProteinID: BAM46444
UniProt: K0IVG2
LinkDB
Position
313341..314441
AA seq 366 aa
MGKINVAIVFGGKSAEHEVSLQSAKNIIDAIDREKYDVVLIGVDKDGCWQVNEEDSFLLN
EHDPKAISLKKTSSKIAILPGEKQGQVFDYETKEVLPQIDVVFPIIHGTLGEDGSMQGLL
RTLNLPFVGVDLLGSAVSMDKDFAKRILRDAGIAVANGLVYKKFEQSNIDFNFVQSKLGL
PLFVKPVNQGSSVGVNKVETKAEFDQAIAEAYMYDDKVLIEEAIVGREIECAVLGNDEPI
ASLPGEILPQTDFYSYESKYIDDSGAVLSAPAELTDEQTEKVQNEAIRVFKTLDCEGMAR
VDFFMKSDGTLIVNEVNTVPGFTKISMYPRLWGITGLPYPKLIDRLIELAFERHERKQQL
KSAVFE
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggggaagataaatgtagccattgtgttcggtggtaagtctgcagaacatgaggtttca
cttcaatcagctaagaatattattgatgcgatagatcgtgagaaatacgatgttgtgtta
attggcgtcgataaggacggttgttggcaagtaaatgaggaagattcatttttacttaat
gagcacgaccctaaagctatttcactcaaaaaaacaagcagtaagattgctattttacca
ggagaaaagcaaggacaagtatttgactatgagacgaaagaagtcttgcctcaaattgat
gttgtttttccaattattcatggaactcttggtgaagacggtagtatgcaaggattatta
agaacgcttaatctgccttttgtcggggttgatttattaggttcagcggtaagtatggat
aaagattttgccaagcggattttacgtgatgcaggaatcgctgttgctaatgggcttgtc
tataagaaatttgaacaatcaaatattgatttcaactttgtccaaagtaaattaggctta
ccattattcgttaagccagttaatcaaggatcatcagttggggtaaataaagttgaaaca
aaggctgagttcgatcaagcgatagccgaagcgtatatgtatgacgataaagttttaatt
gaggaagcaatcgtaggtcgtgaaattgagtgtgctgttcttggtaatgatgagccaatt
gcttcattgccaggtgaaatcctccctcaaacagacttttactcatatgaatcaaaatat
attgatgattcaggagcggtattgtcagcaccagcagaattaacggatgaacaaacggaa
aaagttcaaaatgaagctattcgagtgtttaagacgttagattgtgaaggaatggcgcga
gttgatttctttatgaagtcagatggaacattaatcgtaaatgaagtgaatactgttccc
ggttttacgaaaatcagtatgtatcctcgattatggggaataactggattaccatatcct
aagctgattgatcgcttaattgagttagcattcgagcgtcacgaacgaaagcaacaatta
aaaagtgccgtatttgaataa

DBGET integrated database retrieval system