KEGG   Amphibacillus xylanus: AXY_10480Help
Entry
AXY_10480         CDS       T02266                                 

Gene name
apt
Definition
(GenBank) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
axl  Amphibacillus xylanus
Pathway
axl00230  Purine metabolism
axl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AXY_10480 (apt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:axl04147]
    AXY_10480 (apt)
Enzymes [BR:axl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     AXY_10480 (apt)
Exosome [BR:axl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXY_10480 (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: BAM47180
UniProt: K0IXJ6
LinkDB All DBs
Position
1098463..1098978
Genome map
AA seq 171 aa AA seqDB search
MDYKQFITLVEDWPKEGVQFKDITTLMDNGVAYKSAVDEIVQYAKDRQVDIIVGPEARGF
IVGCPVAYALEIGFAPVRKEGKLPREVIKVDYGLEYGKDVLTIHKDAIKPGQRVLITDDL
LATGGTIEATIKLVEELGGVVVGCAFLIELSYLNGRDKLEGYDVLTLMEYN
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggattataaacaatttattacattggtcgaagactggccaaaagaaggcgttcaattt
aaagacattactacgttaatggataatggtgtagcttataaatcagctgtagatgaaatc
gtccaatatgctaaagatagacaagttgacattattgtcggcccagaagctagaggattt
atcgtaggttgtccagttgcatatgcattggaaattggttttgcgcctgttcgtaaagaa
ggtaaattaccacgtgaagtcattaaggtagattatggtttagagtacggtaaagatgtg
ttaaccattcataaagatgcaatcaaaccaggacaacgtgttttaatcacagatgacttg
ttagctactggtggaacgattgaagcaacaatcaagcttgtagaagaactaggcggggtt
gtagttggttgtgcatttttaattgaattatcatatctaaatggacgagataagcttgaa
ggttatgatgttttaacattaatggaatacaattaa

DBGET integrated database retrieval system