KEGG   Amphibacillus xylanus: AXY_19320Help
Entry
AXY_19320         CDS       T02266                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
axl  Amphibacillus xylanus
Pathway
axl00620  Pyruvate metabolism
axl00680  Methane metabolism
axl01100  Metabolic pathways
axl01120  Microbial metabolism in diverse environments
axl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:axl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXY_19320 (ppc)
  Energy metabolism
   00680 Methane metabolism
    AXY_19320 (ppc)
Enzymes [BR:axl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AXY_19320 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: BAM48064
UniProt: K0IZV2
LinkDB All DBs
Position
2005465..2008221
Genome map
AA seq 918 aa AA seqDB search
MQQFDLQLSNITLNHDVEYLNDILDGVLRQEGGEELLNTFKHFRNLSKALRDDETTNNFD
LLNKEIKKLDSRLREKIIRAFSVNLQLYNIAEQNYRIRRRRYYQMQDDTVIQPRSLEEGV
NQLFDNNISIEQVESALEKLSLELVITAHPTEATRRTMLRIHQKIAELLKQREYSYTRYD
KKVIREKIETEITILWQTAEIREKKPSVMKEVSNGLYYFEKVLFDVLPLIHQDLEDLLED
KYNHRFHVPSFLRFGSWIGGDRDGNPFVTAETTMQTLREHRKLVLSKYIESITKLREKLS
QSTKKVNVSGALVKSIADDQAELNYNGWHKEDEVYRVKLGLILRRLRLTSFEDEAGYRDS
HALLDDLLLIQESLEMHHPKSNPIKLLRKVIRQVELFGFHLATLDIRNHSGEHENTIAEI
FRLVGIAKDYKSLDEEEKISTLISVLEDPRPLISIYDEFSPEAQEMIETFRTIKVAKDKF
GERAIEVYLVSMTTSVSDVLEVLVLAKEVGLYRVYPNGRVRSRIHVAPLLETIDDLKFGP
TLIKRLFDIPLYRKHIEARGDLQEVMLGYSDGSKDGGNITANWELFKAQEEIHSIAAEYG
VKLKYFHGRGGSLGRGGGPLYSSILSQPVITLGDGVKITEQGEVLSSRYLLSDIAYRSLE
QATSVMLTSIGGIMQTDKQELMPTEEAYQALSYASDVAFKKYQDLVFGDPDFLTYFNQGT
PLNELGELNIGSRPMKRKGSEKFEDLRAIPWVFAWTQARQLIPAWYATGTGLQAYLDKTN
NIELYREMYAHWPFFQATVNNLQMALTKADLDIAEVYIEMIGDCEVAKRIFGQIKEEYDL
TKKIVLEITQQEELMDHQPNIKESVRLRNPLVDPLNLIQVQLLNQLRLLDDEDQAYTQLL
EEVLLTINGIAAGLRNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatttgatttgcaattaagtaacattacactgaatcatgatgtagaatatctc
aatgatattcttgacggtgtgttacgacaagaaggtggagaagagcttctaaataccttc
aaacatttccgaaatttatcaaaagcattacgtgatgatgaaacgacaaacaactttgac
ctattaaataaagagattaagaaacttgattcacgtctaagagagaaaattattcgtgct
ttttcggtaaatttacaactttacaatatagctgaacagaattatcgcattagacgtaga
cgttattatcaaatgcaagatgatacagtcattcagcctcgttcactagaagaaggtgtc
aaccaattattcgataataatatttcaattgaacaggttgaaagtgcgttagagaaatta
tcgttagagcttgtgattacagcacacccaacagaagcgacgcgacgcacaatgttacgt
attcatcagaaaatcgcagaactactcaagcaacgtgagtactcttatacacgttatgac
aaaaaggtaattagagaaaagattgaaactgagattacaattctctggcaaacagcggaa
atcagagagaaaaagccttctgttatgaaggaagtctcaaatgggctttactactttgaa
aaagttttattcgatgtcttaccacttattcatcaagatttagaggacttattagaagat
aaatataatcatcgttttcatgtgccttcattcttacgttttggatcttggattggtgga
gacagagatggtaacccatttgtaacagcggaaacgacgatgcaaacattaagagaacat
cgtaagcttgtcctatcaaaatatattgaatcaattacaaaattacgtgaaaaactaagt
caatcgactaagaaagtaaatgttagtggtgcacttgttaagtctattgcagatgaccaa
gctgagttaaattacaatggttggcataaagaagatgaagtgtaccgagtaaaacttggt
ctgattttacgtcgattaagattgacctctttcgaggatgaagctggttatcgagattca
catgcattacttgatgatctattactcattcaagaaagccttgaaatgcaccatccaaag
agcaatccaattaaactacttagaaaagtcattcgtcaagttgaattattcggtttccac
ttagcaaccttagatattagaaaccatagtggtgagcatgaaaatacaattgcagagatt
ttccgattagtcggaattgcaaaagattacaagtcattagacgaagaagagaaaatttca
acgctgatctcagtattagaagatcctcgtccactgatttctatctatgatgaattctca
ccagaagcccaagaaatgattgaaacattccgaacgattaaagtagcgaaagataaattt
ggcgaacgtgcaattgaagtttatcttgttagtatgacgacttccgtcagtgacgtatta
gaagtcctcgtcttagcaaaagaagtcgggctctatcgtgtatatccaaatggacgcgta
agaagtcgcattcatgttgctccattattagagacaattgacgatctgaagtttggacca
acgctaattaaacgtctattcgacattccactgtatcgtaagcatattgaagcacgtggt
gatttacaagaagttatgcttggatattcagatggtagtaaggatggcggtaacatcaca
gctaactgggagctatttaaagcacaagaggaaatccattctattgctgctgagtatggg
gttaaactgaaatatttccatggtcgtggtggctcattaggccgtggtggtggaccgctt
tactcaagtattttatctcaaccagtaatcacacttggtgatggtgttaaaattaccgag
caaggtgaagtattatcatcacgctacctgctttctgatattgcatacagaagtttagag
caagcaacatcagtaatgctgacttctatcggtggcattatgcaaactgataagcaagaa
ctcatgccaactgaagaagcatatcaagcattatcatacgcatcagatgttgcatttaag
aagtatcaagatctcgtctttggtgatccagatttcttaacttactttaaccaaggtaca
ccattaaatgaacttggtgagctcaatattggatctcgtccaatgaagcgtaaaggtagt
gagaagtttgaagacttacgagctattccttgggtgtttgcttggactcaagctcgccaa
ttgatccctgcttggtacgcgacaggaacaggtctacaagcttatttagataaaactaat
aatattgaattgtaccgagaaatgtatgcacactggcctttcttccaggcaacagtgaac
aacctgcaaatggctcttactaaagccgatttagatattgctgaagtatacattgaaatg
atcggtgactgtgaagttgctaagcgtatatttggtcagattaaagaagaatatgatcta
acgaagaaaattgtcctcgagattactcagcaagaagaactgatggatcatcaacctaat
attaaagaatctgtacgcttacgtaatcctttagtagacccgttaaacttaattcaagtt
caactattaaatcaacttcgtctactagatgatgaagatcaagcatatacacaattacta
gaagaagtattactaacaattaacggaattgcagcaggcctccgtaatactggttga

DBGET integrated database retrieval system