KEGG   Amphibacillus xylanus: AXY_22010Help
Entry
AXY_22010         CDS       T02266                                 

Gene name
nox1
Definition
(GenBank) NADH oxidase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
axl  Amphibacillus xylanus
Brite
KEGG Orthology (KO) [BR:axl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXY_22010 (nox1)
Enzymes [BR:axl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AXY_22010 (nox1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_oxidored DAO FAD_binding_2 FAD_binding_3 NAD_binding_7 AlaDh_PNT_C Thi4 NAD_binding_8 Glutaredoxin K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: BAM48333
UniProt: K0J816
LinkDB All DBs
Position
2326999..2328528
Genome map
AA seq 509 aa AA seqDB search
MLDKDIKQQLEQYLALLENDIVIKVSVGDDKVSKDTLELVNEIADMSSMISVEETTLERT
PSFSINRKGEPDSGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEASVIDAIKKVEGKHDF
VTYVSLTCQNCPDVVQALNLMSVVNPNITHTMVEGSAFKDEVDRLNILAVPSVYLNGEFM
ASGRMTIEDILGHLGSGIDASELNEKDPFDVLVIGGGPAGASSAIYAARKGIRVGIIADR
FGGQVMDTLGIENFIGTKYTEGPKLISEIEQHVNEYNIDVMKGLRAHNIEKKDLFEVQLD
NGAVLKSKTIILATGARWRDIGVPGEKEYKNKGVAYCTHCDAPLFEGKHVAVVGGGNSGI
ESALDLAGIVKHVTVFEFMSELKADAVLQERLRSLPNVDVILNAQTTEITGDETVKGISY
IDRTTNEEKHVELQGAFIQIGLAPNTEWLGDTVERNQIGEIVIDKKGQTSVPGIFAAGDC
TDTPYKQIIVSMGAGATAALGAFDYLLRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctagataaagatataaaacaacaacttgaacaatatctagctctattagaaaacgat
atcgtcatcaaagtaagtgttggtgacgataaagtttctaaagatacacttgaacttgtt
aacgaaattgctgacatgtcttcaatgatttcagtcgaagaaacgactttagagcgaaca
ccaagctttagtattaatcgtaagggtgaaccagatagtggtgttgtatttgcaggtatt
ccactaggtcatgaatttacatcactcgttcttgccttactacaagttagcggacgcgca
cctaaagttgaagcatctgtaattgatgcaattaaaaaggttgaaggcaagcatgacttt
gtaacttacgttagtttaacatgtcaaaactgtccagatgttgttcaagcgcttaactta
atgagtgtagttaatccaaacattacacatacgatggtcgagggatctgcttttaaagat
gaagtagatcgactaaatattcttgccgttccatctgtttatttaaatggagagttcatg
gcaagtggccgtatgacaattgaagatattttaggtcatctaggaagcggtatcgatgct
tctgagcttaacgaaaaagatccatttgacgttcttgtaatcggtggtggacctgccggt
gcaagttcagcaatctatgctgctcgtaaagggattagagttggtattattgctgatcgc
tttggcggtcaagttatggatacacttgggatcgaaaactttatcggtacaaaatatact
gaaggtcctaagctaatctcagaaattgagcaacacgttaacgagtataatattgacgtt
atgaaaggccttcgagctcataacattgagaagaaagatctattcgaggttcaacttgat
aacggtgctgttctaaagagtaaaacaattattcttgcaactggtgcacgttggagagac
attggcgttccaggtgaaaaagagtataaaaataaaggtgtagcatattgtacacactgc
gatgccccactgtttgaaggaaaacacgtagctgttgttggcggtggaaactctggtatt
gaatctgcattagatcttgcaggtatcgttaaacatgtaactgtatttgagtttatgtca
gagttaaaggcagatgcagtactacaagaaagactacgtagcttacctaacgtagatgta
attctaaatgcacagacaactgaaatcacaggtgatgaaacagttaaaggtatctcttac
attgaccgcacaacaaacgaagaaaaacatgttgagttacaaggtgcattcatccaaatt
ggtctagctcctaatactgagtggttaggtgacacagttgagcgaaatcaaatcggtgaa
attgtcattgataagaaaggtcaaacgagtgtaccaggtattttcgctgctggtgactgt
actgacacgccttacaagcaaattattgtatctatgggtgctggtgcaactgccgcactt
ggcgcatttgactatctactacgtaattaa

DBGET integrated database retrieval system