KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_1113
Entry
AX27061_1113      CDS       T02964                                 

Definition
(GenBank) putative membrane protein
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: AHC45578
LinkDB
Position
1188338..1189087
AA seq 249 aa
MSDAAATARKEQNQRQGLIVGTVTLPFQLLGVLIGSLLFSIVVECVGMHLFWKDQGWRHS
QQMLQYELGHLSNHFTRSVVVQEPGRTAHELVDTGYEWVFVRTGLLERMSQTAERARAPS
HEQVRNFRYWISQVYVWAESYLVAAAFTTLTFLVRLLVLVLTLPLIFTAAFVGLIDGLVR
RDVRRFGAGRESGFIYHRAKASLMPLAVLPWVTYLALPISVHPLVILLPSAALLGLAVSL
TAGSFKKYL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagcgatgccgccgccactgcacgtaaagaacagaaccagcggcaaggtctgatcgtc
ggcaccgtcacgctgccgttccagctgcttggggtgctgatcggctcgctgctgttttcc
atcgtggtcgagtgcgtgggcatgcacttgttctggaaggaccagggctggcggcattcc
cagcagatgctgcagtacgagctggggcacctgtccaaccacttcacgcgcagcgtggtc
gtgcaggaaccagggcgcacggcacacgagctggtggataccggctacgaatgggtgttc
gtccgcacgggactattggaacggatgagccagaccgccgaacgagcacgggcgcccagc
catgagcaggtgcggaatttccgctactggatcagccaggtctacgtgtgggccgagagc
tatctcgtcgcagcggcattcacgacgctcacgttccttgttcgcttgctggttctggtg
ctcacgctgccgctgatcttcaccgcggcgttcgtgggtctgatcgacggactggtgcgg
cgggatgtgcgccggtttggggcaggccgggaatccggcttcatctaccacagagcgaag
gcgagcctaatgccgctggccgtactaccctgggtgacgtacttggcactgccgatctcg
gtccatccgttggtgatcctcttgcccagcgctgccttgctgggactggctgtaagcctg
actgcgggcagcttcaagaaatacctatga

DBGET integrated database retrieval system