KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_1226Help
Entry
AX27061_1226      CDS       T02964                                 

Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00020  Citrate cycle (TCA cycle)
axn00480  Glutathione metabolism
axn01100  Metabolic pathways
axn01110  Biosynthesis of secondary metabolites
axn01120  Microbial metabolism in diverse environments
axn01130  Biosynthesis of antibiotics
axn01200  Carbon metabolism
axn01210  2-Oxocarboxylic acid metabolism
axn01230  Biosynthesis of amino acids
Module
axn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
axn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AX27061_1226
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AX27061_1226
Enzymes [BR:axn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AX27061_1226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHC45691
LinkDB All DBs
Position
1323113..1324369
Genome map
AA seq 418 aa AA seqDB search
MSYQHIKVPAGGQKITVNADFSLNVPDQPIVPYIEGDGTGADITPVMIKVVDAAVQKAYG
GKRKIHWMEVYAGEKATKVYGPDVWLPDETLEVVKDYVVSIKGPLTTPVGGGIRSLNVAL
RQQLDLYVCLRPVAYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEYMAESEQAKELIQF
LQTKLGVKKIRFPNTSSIGIKPVSREGTERLVRKAAQYVIDNDRTSLTLVHKGNIMKFTE
GGFRDWGYALLQKEFGAQLIDGGPWCKFKNPKTGREIIVKDVIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHMGWTEAADLIISSMEKSILSKKVTYDFARLLEGATQVSCSGFGQVMIDNM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccaacatatcaaggtgcccgctgggggccagaagatcacggtcaacgctgat
ttctcgctgaacgtgcccgatcagcccatcgtgccctatatcgagggtgatggcacgggc
gcggacatcacccccgtgatgatcaaggtcgtcgacgccgccgtgcaaaaggcctacggc
ggcaagcgcaagatccactggatggaggtctatgccggcgagaaggccaccaaggtctac
ggcccggacgtctggctgcccgacgagaccctggaggtcgtcaaggactacgtggtgtcg
atcaagggcccgctgaccaccccggtcggcggcggcatccgctcgctgaacgtggcgctg
cgccaacagctggatttgtacgtctgcctgcgtccggtggcgtatttcaagggtgtgccg
tcgccggtgcgtgaaccggaaaagacgaacatggtgatcttccgcgagaactcggaggac
atctacgccggcatcgaatacatggccgaaagcgagcaggccaaggaactgatccagttc
ctgcagaccaagctcggcgtcaagaagatccgcttccccaacacctcgtccatcggcatc
aagccggtgtcgcgcgaaggcaccgagcgcctggtgcgcaaggcggcgcagtacgtcatc
gacaatgaccgtacctcgctgaccctggtgcacaagggcaacatcatgaagttcacggaa
ggcggtttccgtgactggggctacgcgctgctgcagaaggaattcggcgcgcagctgatc
gacggcggcccgtggtgcaagttcaagaatcccaagaccggccgcgagatcatcgtcaag
gacgtcatcgccgacgcgttcctgcagcagatcctgctgcgtccggccgaatacgacgtg
atcgccaccctgaacctgaacggcgactacatctccgacgcgctggccgcgcaggtgggc
ggcatcggcatcgccccgggcgccaacctgtcggattcggtcgccatgttcgaggccacg
cacggcacggcgccgaagtacgcgggcaaggactacgtcaacccgggttcggagatcctg
tcggcggaaatgatgttgcgccacatgggctggaccgaggcggccgacctgatcatctcc
agcatggaaaaatcgatcctctcaaagaaggtcacttacgacttcgcgcgcttgctcgaa
ggcgcgacccaggtgtcctgctcgggcttcggccaggtcatgatcgacaacatgtga

DBGET integrated database retrieval system