KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_2411Help
Entry
AX27061_2411      CDS       T02964                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00010  Glycolysis / Gluconeogenesis
axn00020  Citrate cycle (TCA cycle)
axn00620  Pyruvate metabolism
axn01100  Metabolic pathways
axn01110  Biosynthesis of secondary metabolites
axn01120  Microbial metabolism in diverse environments
axn01130  Biosynthesis of antibiotics
axn01200  Carbon metabolism
Module
axn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AX27061_2411
   00020 Citrate cycle (TCA cycle)
    AX27061_2411
   00620 Pyruvate metabolism
    AX27061_2411
Enzymes [BR:axn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AX27061_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 CAT
Motif
Other DBs
NCBI-ProteinID: AHC46874
LinkDB All DBs
Position
2653482..2655149
Genome map
AA seq 555 aa AA seqDB search
MSNVVQIKVPDIGDFKEVEVIEVLVAVGDTIKAEQSLITVESDKASMEIPASQGGVVKSI
AVKVGDKVAEGAVVLEVEAADAAAPAAKEEPKAEAPRQAAAAAPAAKAEAAAPAASSGPV
EIEVPDIGDFKEVEVIEVMVAVGDTIKAEQSLITVESDKASMEIPASQGGVVKEVKVKVG
DKVAKGSVVVVVEGSAPAAAAAPAANAEAAPARSEAPAAKAEAPAAPATPAVGSRPAPAA
ALEDANLKPGQLPHASPSVRKFARELGVNLSKVKGTGPKDRITADDVRGFVKTALASGAA
PAAAGGSADGAALGLLPWPKVDFTKFGPIEAKPLSRIKKISGANLHRNWVMIPHVTNNDE
ADITDLEALRVTLNKENEKSGIKVTMLAFLIKAVVAALKKFPEFNASLDGDNLVLKQYYH
IGFAADTPNGLVVPVIRDADKKGILQIAQEMTDLSKKAREGKISPAEMQGGCFSISSLGG
IGGTSFTPIINAPEVAILGVSRSSHKPVWDGKQFVPRLIVPLSLSYDHRVIDGAAAARFN
AYLGALLADFRRIAL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgtcgtgcaaatcaaggttcccgacatcggcgacttcaaggaagtggaagtc
attgaagtgctggtggcggtgggcgacacgatcaaggccgagcagagcctgattaccgtc
gaatccgacaaggcctcgatggaaatccccgcctcgcagggcggggtggtgaagtcgatc
gcggtcaaggtcggcgacaaggtcgccgaaggcgccgtggtgctcgaggtggaagcggcc
gacgccgccgccccggccgccaaggaagaacccaaggccgaggcgcccaggcaggctgcc
gccgccgcgcccgccgccaaggccgaggctgccgcgccggccgccagcagcggtccggtc
gagatcgaagtgccggacatcggcgacttcaaggaagtggaagtcatcgaagtcatggtc
gccgtgggcgacaccatcaaggccgagcagagcctgatcaccgtcgagtccgacaaggcc
tcgatggagatcccggcctcgcagggcggggtggtcaaggaagtgaaggtcaaggtcggc
gacaaggtcgccaagggctcggtcgtggtcgtggttgaaggcagcgcgcccgccgccgcg
gccgcgccggccgccaacgccgaagccgcgccggccaggtcggaagccccggccgccaag
gcggaagcgcccgcggccccggccacgcccgccgtcggctcgcgcccggccccggccgcc
gcgctggaagacgccaacctcaagcccggccagctgccgcacgcctcgccgtcggtgcgc
aagttcgcccgcgaactgggcgtgaacctgagcaaggtcaagggcaccggtcccaaggac
cgcatcaccgccgacgacgtgcgcggtttcgtcaagaccgcgctggcctcgggcgccgcc
ccggccgccgccggcggttcggccgatggcgccgcgctgggcctgctgccgtggcccaag
gtcgacttcaccaagttcggcccgatcgaagccaagccgctgtcgcgcatcaagaagatc
tccggcgcgaacctgcaccgcaactgggtcatgatcccgcacgtcaccaacaacgacgaa
gcggacatcaccgacctggaagcgctgcgcgtcacgctgaacaaggaaaacgagaagtcg
ggcatcaaggtcacgatgctggccttcctgatcaaggccgtggtcgcggccctgaagaag
ttccccgagttcaacgcctcgctggacggcgacaacctggtgctcaagcagtactaccac
atcggctttgccgccgatactcccaacgggctggtggtgccggtgatccgcgatgccgac
aagaagggcatcctgcagatcgcccaggaaatgaccgacctgtccaagaaggcgcgcgaa
ggcaagatctcgcccgccgaaatgcagggcggctgcttctcgatctcgtcgctgggcggt
atcggcggcacgtcgttcacgcccatcatcaatgcgcccgaagtggccatcctgggcgtg
tcgcgttcgtcgcacaagcccgtctgggacggcaagcagttcgtgccgcgcctgatcgtg
ccgctgtcgctgtcctatgaccaccgcgtcatcgacggcgccgccgctgcccgcttcaac
gcctatctcggcgccttgctggccgacttccgccgcatcgcgctgtaa

DBGET integrated database retrieval system