KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_2575Help
Entry
AX27061_2575      CDS       T02964                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00564  Glycerophospholipid metabolism
axn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AX27061_2575
Enzymes [BR:axn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AX27061_2575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Pyr_redox_2 GIDA FAD_binding_3 Thi4 Pyr_redox_3 Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AHC47037
LinkDB All DBs
Position
complement(2816423..2818021)
Genome map
AA seq 532 aa AA seqDB search
MNQPLATVTPPDRNRLLAQLDNTPAWDVIVIGGGATGLGTAVDAASRGYRTLLIEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLVWPLGFVVPAYNLLDQP
FYGVGLKMYDMLAGKLNLSPSRWLSRRETLANAPTLAENVNGRGLKGGVLYYDGQFDDAR
LALSLMRTLFDLGGTAVNYVRATGLTTTGGKVDGVTAEDALGGASFTLRARCVINATGVW
VDSVRRMEDKNAPTMVAPSQGVHLTLPHDFLPGKRAILIPKTDDGRVLFVVPWNGHTIVG
TTDSPRNDLPLDPEAGAEDVDFILNTAARYLSRKPTRDDVTSVWAGLRPLVKATGDASTK
SLSREHTILVSQAGLVTVTGGKWTTYRRMAQDVVDTAIQHQLLTQASCRTESLALHGANG
LAPSQEHAGTPDSYYGSDLATLKALPGAERMLVRSSGLSEAHVRFAARFELARSAEDVLA
RRNRALFLDAEAAMLAAPEVARILAEELGQDAAWQQRTLQELAGVAAHYRLK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaccgctcgccaccgtcaccccgcccgaccgcaaccgcctgctggcgcaactg
gacaacacgcctgcctgggacgtgatcgtcatcggcggcggcgcgaccggcctgggcacc
gccgtcgacgccgccagccgcggctaccgcacgctgctgatcgaggccgccgacttcgcc
aagggcacctccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcgcaa
ggcaacatcagcctggtgcgcgaggcactgcacgaacgcggcctgctcaaccgcaacgcg
ccacacctggtgtggccgctgggcttcgtggtgccggcctacaacctgctggaccagccg
ttctacggcgtgggcctgaagatgtacgacatgctggccggcaagctcaacctgtcgccc
agccgctggctgtcgcgccgcgagacgctggccaacgcgccgacgctggccgaaaacgtc
aacggccgcggcctgaagggcggcgtgctgtactacgacggccagttcgacgacgcgcgc
ctggcgctgagcctgatgcgcaccctgttcgacctgggcggcacggcggtcaactacgtg
cgcgccaccggcctgaccaccaccggcggcaaggtcgacggcgtcaccgccgaggacgcg
ctgggcggcgccagcttcacgctgcgcgcgcgctgcgtgatcaacgccaccggcgtctgg
gtcgacagcgtgcgccgcatggaagacaagaacgcgcccaccatggtggcgcccagccag
ggcgtgcacctgacgctgccgcacgacttcctgcccggcaagcgcgccatcctgatcccc
aagaccgacgacggccgcgtgctgttcgtggtgccgtggaacggccacaccatcgtcggc
accaccgattcgccgcgcaacgacctgccgctggacccggaagccggcgccgaggacgtc
gacttcatcctgaacaccgccgcgcgctatctcagccgcaagccgacccgcgacgacgtc
accagcgtctgggcgggcctgcggccgctggtcaaggccaccggcgacgcctccaccaag
tcgctgtcgcgcgagcacaccatcctggtgtcgcaggcggggttggtgacggtcacgggc
ggcaagtggaccacctatcgccgcatggcgcaggacgtggtcgacaccgccatccagcac
cagttgctgacgcaggccagctgccgcaccgagtcgctggcgctgcatggcgccaacggc
ctggcgccgtcgcaggaacacgccggcacgccggacagttactacggcagcgacctggcc
acgctcaaggccctgcccggcgccgaacgcatgctggtcaggagcagcggcctgtcggaa
gcgcatgtgcgtttcgccgcgcgcttcgaactggcgcgcagcgccgaggacgtgctggcg
cgccgcaaccgcgcgctgttcctggacgccgaggcggccatgctggccgcgcccgaagtg
gcgcgcatcctggccgaggaactgggccaggatgccgcctggcagcagcgcacgctgcag
gaactggccggcgtggcggcgcactatcggctgaaatga

DBGET integrated database retrieval system