KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_2773
Entry
AX27061_2773      CDS       T02964                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K11208  GST-like protein
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Brite
KEGG Orthology (KO) [BR:axn00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    AX27061_2773
SSDB
Motif
Pfam: GST_N_2 GST_N_3 GST_N
Other DBs
NCBI-ProteinID: AHC47235
LinkDB
Position
3032016..3032657
AA seq 213 aa
MMKTYELIGSQGCGSAIVEMALALANVPHTLTDVPYLKPGPERERLLRLNPLGQVPTLIT
PDGEVMTESAAMVLHLHDVAPQAGLAPEASRPERARFLNLLVRLVAAVYPTFTYGDDPPQ
WTTPGAPAELLRERIHGRRAEVWLELERQAGTPHMLGRRFSALDLYVTVMTHWRPGPAWF
EANCPALTAVARQAAQEPNVARVLKRNFPPPTE
NT seq 642 nt   +upstreamnt  +downstreamnt
atgatgaaaacctacgaattgatcggctcgcagggctgcggttcggccatcgtcgagatg
gcgctggcgctggccaacgtgccgcacacgctgaccgacgtgccgtacctgaagcccggg
cccgagcgcgagcggctgttgcgcctgaacccgctggggcaggtgccgacgctgatcacg
ccggacggcgaggtgatgaccgaaagcgcggccatggtgctgcatctgcatgacgtggcg
ccccaggcgggcctggcgccggaagcctcgcggcccgagcgcgcgcgcttcctgaacctg
ctggtgcggctggtggcggcggtctatccgaccttcacctatggcgacgacccgccgcaa
tggaccacgccgggcgcgccggccgagctgctgcgtgaacgcatacacggccgccgcgcc
gaagtgtggctggaactggagcgccaggccggcaccccgcacatgctgggccgccgcttt
tcggcgctggacctgtacgtgacggtgatgacgcattggcggcccggcccggcctggttc
gaggccaactgtccggccttgacggcggtggcgcgccaggcggcgcaggaaccgaacgtg
gcgcgcgtgctcaagcgcaatttcccgccgccgaccgagtag

DBGET integrated database retrieval system