KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_4222Help
Entry
AX27061_4222      CDS       T02964                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:axn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AX27061_4222
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:axn03400]
    AX27061_4222
Enzymes [BR:axn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AX27061_4222
DNA repair and recombination proteins [BR:axn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AX27061_4222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AHC48681
LinkDB All DBs
Position
complement(4679787..4682411)
Genome map
AA seq 874 aa AA seqDB search
MADTLAKYRAKRNFNVTSEPAEGGQANEAARAFVIQKHWASRLHYDFRLELDGAMKSWAV
PKGPSYDPSVKRMAVQVEDHPIAYNRFEGEIPKGQYGAGKVIIWDRGTWAPVGDPADGYR
RGHLKFDLHGVKMRGRWALIRMKGRESEKQPPWLLVKDRDEHARAESEFSVVDEQPDSVA
TPPRTGARAVPAAAPGARPDAAASPSASPSSSAPPSSDAGAAGLPGEAAPLPELLKPQLA
TLVEGVPRQAGDDWIYEMKFDGYRLLARLRDGQVRLYTRNGHDWGPKLPHLARALQRLPL
PDAWIDGEIVMLADNGAPSFQALQNAFDGERTDGILFYAFDLPYVTGRDLRQEPLRVRRA
VLARVMEAAGGDPLRFSEAFDAAPADLVASACKMGLEGIIAKRLSAPYVSRRSDSWVKLK
CARRQEFVIAGYTDPKGARVGLGALLLAYHDEDGGLVYAGKVGTGFDDMGLAALQRRLSA
LETERPAVKAAGIGRGVHWVRPELVAEVSFGEWTASGHVRHPVFRGLRTDKPARAITREA
AMGADTMQSDNAAGKTGNAKTGKAKPGNARTGKAKAGKAKPGAGKLTHPERIIDPSTGLT
KLDLARYDGLVAPLLLRHLKDRPVSFLRAPSGLKGEFFFQKHLEAPMPGVRPLPQELDPD
HPPLMEVPTPQAIMSAAQMNVVEFHTWNAVKSAIDKPDRMLFDLDPGEGVAWPSMQQAAR
LVHVMLREIGLRSWLKTSGGKGLHVVVPLRRQYDWDTVKAFSQAIVQHLARTLPQVFVAK
SGPKNRVGRIFADYLRNGFGATTVAAWSARARPGMGVSVPLAWDELDEVRASDQWTIANI
HTRLDVGDAPWDDYTPQALGAAMKAMDFKPDSGG
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggccgataccctggcgaaataccgcgccaagcgcaatttcaatgtgacgtcggagccg
gccgaaggcggccaggccaacgaggcggcgcgcgccttcgtgatccagaagcactgggcc
agccgcctgcactacgacttccggctggaactggatggcgccatgaagagctgggccgtg
cccaaggggcccagctacgacccgtcggtcaagcgcatggccgtgcaggtggaggaccac
ccgatcgcctacaaccgtttcgagggcgagatccccaagggccagtacggcgccggcaag
gtgatcatctgggaccggggcacctgggcgccggtgggcgatccggccgacggctaccgg
cgcggccatctcaagttcgacctgcatggcgtcaagatgcgcggacgctgggcgctgatc
cgcatgaagggccgcgagtcggaaaagcagccgccctggctgctggtcaaggaccgcgac
gaacacgcccgcgccgaaagcgaattcagcgtggtggacgagcagcccgacagcgtggcc
acgccgccgcggacgggcgcgcgggccgtgcccgccgcggcgcccggggcgcggccggat
gcggccgcatcgccgtcagcatcgccgtcatcgtccgcgccgccgtcgtcggacgccggg
gcagcgggcctgccgggcgaggcggcgcccttgccggagctgctcaagccgcaattggcc
acgctggtggaaggcgtgccgcgccaggccggcgatgactggatctacgagatgaagttc
gacggctaccgtctgctggcgcggctgcgggacggccaggtgcgcctgtacacgcgcaac
ggccacgactgggggccgaagctgccgcacctggcgcgggcgctgcagcgcctgccgctg
cccgacgcctggatcgacggcgagatcgtgatgctggccgacaacggcgcgcccagcttc
caggcgctgcagaatgccttcgacggcgaacgcaccgacggcatcctgttctacgcgttc
gacctgccctacgtcaccggccgcgacctgcgccaggagccgctgcgcgtgcgccgcgcg
gtgctggcgcgggtgatggaggccgccggcggcgatccgctgcgctttagcgaagccttc
gacgcggcgccggcggacctggtggcctcggcctgcaagatggggctggagggcatcatc
gccaagcgcctgtccgcgccctacgtatcgcgccgcagcgacagctgggtcaagctcaag
tgcgcccgccggcaggaattcgtcattgccggctataccgatcccaagggcgcgcgggtg
gggctgggcgcgctgctgctggcgtaccacgacgaggacggcgggctggtctacgccggc
aaggtcggcaccggctttgacgacatgggcctggcggcgctgcaacgccgcctgagcgcc
ctggaaacggagcggcccgccgtcaaggcggccggcattggccgcggcgtccattgggtg
cgtcccgagctggtggcggaagtgtcgttcggcgaatggaccgcttcggggcatgtgcgc
caccccgtgttccgcggcttgcgcaccgacaaaccggcgcgcgcgatcaccagggaggcg
gcgatgggggccgatacgatgcagtccgacaatgcggccggcaagaccggcaacgccaag
acaggcaaagccaagcccggcaacgccaggactggcaaagccaaggcgggcaaggccaag
ccaggcgccggcaagctgacccacccggaacgcatcatcgatccgtccacggggctgacc
aagctggacctggcgcgttacgacgggctggtggcgccgctgctgctgcggcacctgaag
gaccggcccgtttcctttctgcgcgccccgtccggcctgaagggcgagttctttttccag
aagcacctggaggcgccgatgccgggcgtgcggccgctgccgcaggaactggacccggat
catccgcccttgatggaggtcccgacgccgcaggcgatcatgtcggcggcgcagatgaac
gtggtcgagttccacacctggaacgcggtgaaaagcgcgatcgacaagcccgaccgcatg
ctgttcgacctggacccgggcgagggcgtggcctggccgtcgatgcagcaggcggcgcgg
ctggtccacgtgatgctgcgcgaaatcggtttgcgcagctggctcaagaccagcggcggc
aagggcctgcacgtggtggtgccgctgcgtcggcaatacgactgggacaccgtcaaggcg
ttctcgcaggccatcgtgcaacacctggcgcgcacgctgccgcaggtgttcgtggccaag
agcgggccgaagaaccgcgtcggcaggatcttcgccgactacctgcgcaacggcttcggc
gccacgacggtggcagcctggtcggcgcgcgcgcggccgggcatgggcgtgtcggtgccg
ctggcctgggacgagctggacgaggtccgggccagcgaccagtggaccatcgccaacatc
cacacgcgcctggatgtcggcgacgcgccctgggacgactacacgccgcaggcgctgggc
gcagccatgaaggcgatggacttcaagccggattcgggcgggtag

DBGET integrated database retrieval system