KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_4661Help
Entry
AX27061_4661      CDS       T02964                                 

Definition
(GenBank) Phosphonopyruvate hydrolase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00440  Phosphonate and phosphinate metabolism
axn01100  Metabolic pathways
axn01120  Microbial metabolism in diverse environments
axn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AX27061_4661
Enzymes [BR:axn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AX27061_4661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: AHC49118
LinkDB All DBs
Position
complement(5151599..5152471)
Genome map
AA seq 290 aa AA seqDB search
MHRHARFRQKLQAPVLMHAMSAHNPLSAKLAAEAGFDAIWGSGFELSASHAVPDANILSA
GLHLEMMRAIAAVVDVPVIADIDTGFGNAINVAYVVPQYEAAGVSAVVMEDKTFPKDTSL
RADGRQELVRVAEFQGKIEAACAARRDPDFCVIARTEALIAGLGQAEALARAAAYEAAGA
DAILIHSKQTTPDEVLAFIAAWSGRVPLVLVPTAYPQLREADIQALGKVGLVIYGNHAIR
AAVGAMREVFARIRNDGGIHGVDAGLPTVRDIIDLQGDADMRELERRYLR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgccacgcacgctttcgccagaaattgcaggctcccgtcctgatgcacgccatg
tcggcgcacaacccgctgtcggccaagttggcggccgaggcgggcttcgacgcgatctgg
ggcagcggcttcgaactgtcggccagccatgcggtgccggacgccaacatcctgtcggcc
ggcctgcacctggagatgatgcgggccatcgcggcggtggtcgatgtgccggtcatcgcc
gatatcgatacggggttcggcaacgccatcaatgtcgcctatgtcgtgccgcaatacgaa
gcggcgggcgtgtcggccgtggtcatggaagacaagacctttcccaaggacaccagcctg
cgcgccgatggccgccaggaactggtgcgcgtcgcggaattccagggcaagatcgaggcc
gcctgcgcggcgcgccgcgatccggatttctgcgtcattgcccgcaccgaggcgctgatc
gccgggctcggccaggccgaggcgctggcgcgcgcggcggcctacgaggccgccggcgcc
gatgccatcctgatccattccaagcagaccacgcccgacgaggtgctggccttcatcgcg
gcctggtccggccgcgtgccgctggtgctggtgccgaccgcctatccgcaattgcgcgag
gccgatatccaggccctgggcaaggtggggttggtgatctacggcaatcacgcgatccgc
gccgccgtgggcgccatgcgcgaggtgttcgcccgcatccgcaatgacggcggcatccat
ggcgtcgatgccggcctgcccacggtgcgcgatatcatcgacctgcagggcgatgcggac
atgcgcgaactggagcgcaggtacctgcgctga

DBGET integrated database retrieval system