KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_4908Help
Entry
AX27061_4908      CDS       T02964                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AX27061_4908
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:axn02000]
    AX27061_4908
Enzymes [BR:axn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AX27061_4908
Transporters [BR:axn02000]
 Other Transporters
  Pores ion channels [TC:1]
   AX27061_4908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: AHC49364
LinkDB All DBs
Position
complement(5424071..5424685)
Genome map
AA seq 204 aa AA seqDB search
MLTLYHAPRSRSFRILWLLEELGVPYDTEMVSIRRRDGSGHIPPDYIDIHPHGKVPALVH
DGVPVFETPAIALYLTDLFPQAGLGPVIGDPQRGPYLTWLAYSTGVFEPAMTERVFKTAH
QQGTMGWGSADEVEQVVTRVLQARPYFLGEHFSAVDIVLGGTLQFMMQMKVIAENPVFSA
YAERLAARPAMHRALQRDGDIGEG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccctctatcacgccccgcgctcgcgctctttccgcatcctctggctgctcgaa
gagctgggcgtgccctacgacaccgagatggtgtcgatccgccgccgcgacggctccggc
catatcccgcccgactacatcgacatccacccgcacggcaaggtgccggcgctggtgcac
gacggggtgccggtgttcgaaacccccgccatcgcgctttacctgaccgacctgttcccc
caggccggcctgggtccggtcatcggcgatccgcaacgcggtccctacctgacctggctg
gcctactcgaccggcgtgttcgagcccgccatgacggagcgcgtgttcaagacggcgcac
cagcagggcacgatggggtggggctcggccgacgaggtcgaacaggtcgtgacccgggtg
ctgcaggcccgcccgtatttcctcggcgagcatttcagcgccgtcgacatcgtgctgggc
ggcaccttgcagttcatgatgcagatgaaggtgattgccgagaacccggtgttctcggcc
tatgccgaacggctggcggcgcgtccggcgatgcaccgcgccttgcagcgcgacggtgac
atcggcgaaggctga

DBGET integrated database retrieval system