KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_4948Help
Entry
AX27061_4948      CDS       T02964                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AX27061_4948
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:axn01002]
    AX27061_4948
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:axn01011]
    AX27061_4948
Enzymes [BR:axn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AX27061_4948
   3.4.21  Serine endopeptidases
    3.4.21.-  
     AX27061_4948
Peptidases [BR:axn01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   AX27061_4948
Peptidoglycan biosynthesis and degradation proteins [BR:axn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AX27061_4948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 DRIM
Motif
Other DBs
NCBI-ProteinID: AHC49404
LinkDB All DBs
Position
complement(5462782..5464206)
Genome map
AA seq 474 aa AA seqDB search
MGGPRQWLAGGLLALAAGAACAQVPGLPPSVVNAWKASKLPDSSLSLVVQEVGGPRLAAL
NAKEARNPASVMKLVTTWAALSELGPNYVWRTAFMTEPGARPDAKGVLPGPLYLRAGGDP
QFLMQDLWVLLRELRLRGVKQINDLVIDRSIFGQVATDPGAFDGAPDRAYNASPDALMVG
FGAVRILFTPDPAANKWVPLIDPPLPGLKIEGRVEWSDARCPGAPVVTTDPVITQQGVTL
RVGGKVAGSCGEFDLYRLALSQTDYATELFRLLWKELGGTFKGQVRAGMVPGDAVVLASH
DSPTLAEVIRQINKRSNNVMARTLLLTLGAEKGRRPATVASSGAVAKDLLARQGLDMPEL
VIDNGAGLSRDARVSADSLASMLTLAWNSPVMPEYISSLAIAGVDGTVRRRMKGDGTLGM
AHLKTGSLRDVRSIAGYVLGASGKRYVVVSIVNHEQAGAVRAFDDALIAWLAEQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgggccgcggcaatggctggccggtggactgctggccctggccgccggcgccgcc
tgcgcccaggtgccaggcctgccgcccagcgtggtcaacgcctggaaggccagcaagctg
ccggacagttcgctgtcgctggtggtgcaggaagtcggcggcccgcgcctggcggccctg
aacgccaaggaagcgcgcaatccggcctcggtgatgaagctggtcacgacctgggcggcg
ctgtccgaactgggccccaactacgtctggcgcaccgccttcatgaccgagccgggcgcc
cggcccgacgccaagggcgtgctgccggggccgctctacctgcgcgccggcggcgatccg
caattcctgatgcaggacctgtgggtgttgctgcgtgaactgcgcctgcgcggcgtcaag
cagatcaacgacctggtgatcgaccgcagcatcttcggccaggtcgccaccgaccccggc
gccttcgacggcgcgcccgaccgcgcctacaacgccagccccgacgccctgatggtgggc
tttggcgccgtgcgcatcctgttcacccccgatcccgccgccaacaagtgggtgccgctg
atcgacccgccgctgcccggtttgaagatcgagggccgggtcgaatggagcgatgcccgt
tgcccgggcgcgccggtggtcaccaccgatccggtcatcacccagcagggcgtgaccctg
cgcgtgggcggcaaggtggccggctcctgcggtgaattcgacctgtaccggctggcgctg
tcgcagaccgactacgccaccgagctgttccgcctgctgtggaaggaactgggcggcacc
ttcaagggccaggtgcgcgccggcatggtgcctggcgatgccgtggtgctggcctcgcac
gattcgccgacgctggccgaggtgatccgccagatcaacaagcgcagcaacaacgtcatg
gcgcgcacgctgctgctgaccctgggcgcggaaaagggccgccggccggccaccgtggcc
agcagcggcgccgtggccaaggacctgctggcgcggcaaggcctggacatgcccgaactg
gtgatcgacaacggcgcgggcctgtcgcgcgacgcgcgggtctcggccgacagcctggcc
tcgatgctgaccctggcctggaattcccccgtcatgccggagtacatttcatccctcgcg
atcgcgggcgtcgacggcacggtgcggcgccgcatgaaaggcgatggcaccctgggcatg
gcccacctgaaaaccggctcgctgcgcgacgtgcgctcgatcgccggctacgtgctgggc
gccagcggcaagcgctacgtggtggtcagcatcgtcaaccacgagcaggccggcgccgtg
cgggccttcgacgacgccctgatcgcctggctggccgaacaataa

DBGET integrated database retrieval system