KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_5227Help
Entry
AX27061_5227      CDS       T02964                                 

Definition
(GenBank) ATP-dependent DNA ligase LigC
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn03030  DNA replication
axn03410  Base excision repair
axn03420  Nucleotide excision repair
axn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:axn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AX27061_5227
   03410 Base excision repair
    AX27061_5227
   03420 Nucleotide excision repair
    AX27061_5227
   03430 Mismatch repair
    AX27061_5227
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:axn03032]
    AX27061_5227
   03400 DNA repair and recombination proteins [BR:axn03400]
    AX27061_5227
Enzymes [BR:axn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AX27061_5227
    6.5.1.6  DNA ligase (ATP or NAD+)
     AX27061_5227
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AX27061_5227
DNA replication proteins [BR:axn03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AX27061_5227
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AX27061_5227
DNA repair and recombination proteins [BR:axn03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AX27061_5227
   NER (nucleotide excision repair)
    Other NER factors
     AX27061_5227
   MMR (mismatch exicision repair)
    Other MMR factors
     AX27061_5227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AHC49682
LinkDB All DBs
Position
complement(5748111..5749715)
Genome map
AA seq 534 aa AA seqDB search
MKRFAALYQELDRSTATLDKRAALVAYFRDAPPRDAAWALYLLAGGKITSARRKIAAVGE
LRAWVASASDTAPWLVDACYDQVGDLAETLALLVPDPATAAPERGLADWIEEILLPVANR
DEGERREVIVAAWMGLPYAERLVFNKLLTGALRVGVSQRMVQQALAEMSGVAIARIAQRM
LGAWSPSPAFLRDLLSAEELPGDRQQPYPFFLASPLEGDPALLGPIGDWLLEWKWDGIRA
QLIRRRGEVALWSRGEERLDGRFPEVEAAAAALDVDCVMDGELLAWQDDTAGPMPFSALQ
TRIQRLKPGPKWLAEAPVRLLAYDLLELDGADLRELPQTERRARLEALLRRHPDPRLRLS
PIVAPESWDEARLLRAQSRERGVEGFMLKRGAAPYQSGRRRGDWWKWKIDPLTIDAVLLY
AQSGHGRRSTLYTDYTFGLWDGDALVPIAKAYSGLDDKEILELDRWLRAHTRERFGPVRS
VDPVQVFELGFEGVNLSKRHKSGVAVRFPRILRWRHDKRADQADRLDTLKALAR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattcgcggcgttgtatcaggaactggaccgcagtaccgccaccttggacaag
cgcgcggcgctggtggcgtacttccgtgatgcgccgccccgcgacgcggcatgggcgttg
tatctgctggccggcggcaagatcaccagcgcgcgcaggaagatcgcggcggtcggcgaa
ctgcgcgcctgggtcgcgagcgcgtccgacaccgcgccctggctggtggatgcctgctat
gaccaggtcggagacctggccgagacgctggcgctgctggttcccgaccccgccaccgcc
gcgcccgagcgcggcctggccgattggatcgaagagatcctgttgcccgtggccaatcgc
gacgagggcgagcgccgcgaggtcatcgtggccgcatggatgggcctgccctatgcggaa
cgcctggtcttcaacaaactgctgaccggcgccctgcgcgtcggcgtgtcgcagcggatg
gtgcagcaggcgctggcggagatgtcgggcgtggccatcgcgcgcatcgcgcagcgcatg
ctgggcgcgtggtcgcccagccccgccttcctgcgtgacttgctgagcgccgaggaattg
cccggcgaccgccagcagccttaccccttctttctggcttcgccgctggagggcgatccg
gcgctgctggggccgatcggcgactggctgctcgaatggaagtgggacggcatccgcgcg
caattgatacggcggcgcggcgaagtggcattgtggtcgcgcggcgaggagcgcctggac
ggccggtttcccgaggtcgaggccgcggccgcggcgctggatgtggactgcgtcatggac
ggggaactgctggcctggcaggacgacacagccggtcccatgccgttttccgccttgcag
acccgcatccagcgtctcaagcccgggcccaagtggctggccgaggcgccggtgcgcctg
ctggcctacgatttgctggagctggacggcgccgacctgcgcgagctgccgcagaccgaa
cggcgcgcccggctggaagcgttgctgcgccggcatccggacccgcgcctgcggctgtcg
ccgatcgtcgcgcccgaaagctgggacgaggcccgcctgctgcgcgcgcaatcgcgcgaa
cgcggcgtcgagggcttcatgctcaagcgcggcgccgcgccgtaccaaagcggcaggcgg
cgcggcgactggtggaagtggaagatcgatccgctcaccatcgacgcggtgctgctgtat
gcgcagtccggccacggccgccgcagcacgctctacaccgactacaccttcggcctgtgg
gatggcgatgcgctggtgcccatcgccaaggcctattcgggcctggacgacaaggagatc
ctggaactggaccgttggctgcgcgcccacacgcgcgagcgtttcggcccggtgcgctcg
gttgatccggtacaggtgttcgagctgggtttcgagggcgtcaacctgtccaagcgccac
aagtcgggcgtggcggtgcgttttccgcgcatcctgcgctggcggcatgacaagcgcgcc
gaccaggccgaccggctcgacacgctgaaggcgctggcgcgatga

DBGET integrated database retrieval system