KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_5964Help
Entry
AX27061_5964      CDS       T02964                                 

Definition
(GenBank) Shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
axn01100  Metabolic pathways
axn01110  Biosynthesis of secondary metabolites
axn01130  Biosynthesis of antibiotics
axn01230  Biosynthesis of amino acids
Module
axn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AX27061_5964
Enzymes [BR:axn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AX27061_5964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 TsaE AAA AAA_16 AAA_25 Cytidylate_kin2 APS_kinase Zeta_toxin AAA_5 AAA_23 ATP_bind_2
Motif
Other DBs
NCBI-ProteinID: AHC50416
LinkDB All DBs
Position
complement(6563055..6563591)
Genome map
AA seq 178 aa AA seqDB search
MSLPHDLPIFLVGMMGAGKTTIGRGLARALGRDFIDLDHELEARCGVRVPVIFEIEGETG
FRRRESAALEECTQRRNIILATGGGAILAAENRARLRERGIVVYLRASVDELFRRTCRDR
NRPLLATADPRGTLRDLMTLREPFYKEVADLVVETGSMPIHTLVKALLPQLQAFEKQI
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgttgccgcacgacctgcccattttcctggtgggcatgatgggggcgggcaagacc
acgatcggccgtggcctggcgcgtgccctggggcgcgattttatcgatctggaccatgag
ctcgaggcgcgttgtggcgtgcgggtgccggtaatcttcgaaatcgagggcgagaccggt
ttccgtcgccgggaatccgcggccctggaagagtgtacccaacggcgcaacataattctc
gccaccggtggcggcgccatcctggcggccgagaaccgggcgcgcctgcgcgagcgtggc
atcgtggtctatttgcgggccagcgtggacgaattgttccgccgcacctgccgcgatcgc
aaccggcccctgctggccaccgccgatccgcgcggcacgctgcgggacctgatgaccctg
cgcgaaccgttctacaaggaagtcgccgatctggtggtggaaaccggctccatgcccatc
cacaccctggtcaaggcgctgttgccgcaattacaagccttcgagaagcagatatga

DBGET integrated database retrieval system