KEGG   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061: AX27061_5965Help
Entry
AX27061_5965      CDS       T02964                                 

Definition
(GenBank) Multimodular transpeptidase-transglycosylase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
axn  Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
Pathway
axn00550  Peptidoglycan biosynthesis
axn01100  Metabolic pathways
axn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:axn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AX27061_5965
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AX27061_5965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:axn01003]
    AX27061_5965
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:axn01011]
    AX27061_5965
Enzymes [BR:axn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AX27061_5965
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AX27061_5965
Glycosyltransferases [BR:axn01003]
 Polysaccharide
  Bacterial polysaccharide
   AX27061_5965
Peptidoglycan biosynthesis and degradation proteins [BR:axn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AX27061_5965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AHC50417
LinkDB All DBs
Position
6563812..6566259
Genome map
AA seq 815 aa AA seqDB search
MSKPQNSSKKDKPANNGSPILRFFVKTGIFFAGLFLCGVLLAGMALALAWPNLPDLHAMT
DYRPRVPLRVYTADKVLIGEFGEERRNVLRFNEIPDVMKSAVLAAEDDRFYQHGGIDWTG
VVRAGLTNLINMSKTQGASTITMQVARNFYLSSEKTYSRKFYELLLTFKIESELTKDQIL
ELYMNQIYLGHRAYGFAAASRTYFGKPLSEVTPAEAAMLAGIPKAPSRFNPISNRPRAEL
RQRYVLGRMLSLGYLTEPEYKTAMAQQIVMKSAEGTPAGGYSIHGEYVAELARQLLFNVY
QDNVYSRGINIYTTVQSKDQEAAYRAVREGVLEYTRRAPYPGPEEQLDLPAGTENNPQAL
DEFLDGVFDKFSDSGDLLTAVVLSASPTEVKLARSSREIITVTDKKVLGVVARALNDKAK
PEQRIKRGSVVYIRKLGDNWEIINLPSVQAAFVALSPQDGAIRAMVGGFDFYRGNFNRVT
QAWRQPGSNIKPFIYAASLERGLTPATQISDQPFELTAAQTGSKAWNPKNYGNQYEPMLT
LRQGLYKSKNMVSIRILQAIGPQYAQDYLTRFGFDKARQPAVLPLALGAGSVTPLQLAGA
FSVFANGGYRVTPYLIDRVTDSNGKIVMQAKPTVAGDAAARAIDPRTAWIMDDVLRGVAT
YGTAARARVLLKRNDIAGKTGTTNESVDAWFSGYTPSLVATAWLGFDQPKSLGSRETGGG
VAMPIWVDYMQDVLKGVPEEKPRPRPDGIIVENGEYYFSEFPPGQAVARLGLPQADTLGE
FLNGLNSDSGEDNRIRVAPGVGTQNAQPWSQKIPF
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgcagaattcctccaaaaaagacaagcccgccaataacggttccccgata
ttgcgttttttcgtcaagaccggcattttctttgccggcctgttcctgtgcggcgtgctg
ctggcgggcatggcgctggccctggcctggcccaacctgcccgacctgcacgccatgacg
gactaccgccccagggtgccgctgcgcgtctatacggcggacaaggtgctgatcggcgag
ttcggcgaagagcgccgcaatgtgctgcgcttcaatgaaatcccggacgtgatgaagtcc
gcggtgctggcggccgaagacgaccgcttctaccagcacggcgggatcgactggaccggc
gtggtgcgcgccggcctgaccaacctgatcaacatgtccaagacgcagggcgcgagcacg
atcaccatgcaggtggcgcgcaatttctacctgtcgtccgaaaagacctattcgcgcaag
ttctacgaactgctgctgacgttcaagatcgaatcggagctcaccaaggaccagatcctc
gagctctacatgaaccagatctacctgggccaccgcgcctacggcttcgccgccgcctcg
cgcacctacttcggcaagccgctgtcggaagtgacgccggccgaggccgcgatgctggcc
ggcatccccaaggcgccttcgcgtttcaacccgatctccaaccgcccccgcgccgagctg
cgccagcgctacgtgctgggccgcatgctgtcgctgggctacctgaccgagcccgagtac
aagacggcgatggcgcagcagatcgtcatgaagtccgccgaaggcacgcccgccggcggc
tacagcatccacggcgagtacgtggccgaactggcgcgccagctgctgttcaacgtgtat
caggacaacgtctattcgcgcggcatcaacatctacaccacggtccagtccaaggaccag
gaagcggcctaccgcgccgtgcgcgaaggcgtgctcgaatacacccgccgcgcgccctac
cctggccccgaagaacagctcgacctgcccgcgggcaccgagaacaacccccaggccctg
gacgaattcctggatggcgtgttcgacaagttcagcgacagcggcgacctgctgaccgcg
gtggtgttgtcggccagccccaccgaagtgaagctggcgcgcagctcgcgcgagatcatc
accgtcaccgacaagaaggtgctgggcgtggtggcgcgcgcgctcaacgacaaggccaag
cccgagcagcgcatcaagcgcggctccgtggtctatatccgcaaactgggcgacaactgg
gaaatcatcaacctgccgtcggtgcaggcggccttcgtcgcgctgtcgccgcaggacggc
gcgatccgcgccatggtcggcggcttcgacttctatcgcggcaacttcaaccgcgtgacg
caggcctggcgccagccgggctcgaacatcaagccgttcatctacgccgcgtcgctcgag
cgcggcctgacgccggccacgcagatctccgaccagccgttcgaactgaccgcggcgcag
accggctccaaggcctggaacccgaagaactacggcaaccagtacgagcccatgctgacg
ctgcgccagggcctgtacaagtccaagaacatggtctcgatccgcatcctgcaggccatc
ggcccgcagtacgcgcaggactacctgacccgcttcggctttgacaaggcgcgccagccc
gcggtgctgccgctggcgctaggcgccggctcggtgacccccctgcaactggccggcgcg
ttctcggtgttcgccaacggcggctaccgcgtcacaccctacctgatcgaccgcgtcacc
gacagcaacggcaagatcgtgatgcaggccaagcccaccgtggccggcgacgccgcggcc
cgcgccatcgacccgcgcaccgcctggatcatggacgacgtgctgcgcggcgtggccacc
tacggcaccgccgcccgcgcccgcgtgctgctcaagcgcaacgacatcgccggcaagacc
ggcaccaccaacgaatccgtggacgcctggttctcgggctacacgccctcgctggtggcc
accgcctggctcggcttcgaccagcccaagtcgctgggttcgcgcgaaaccggcggcggc
gtggccatgccgatctgggtcgactacatgcaggacgtgctcaagggcgtgccggaagaa
aagccgcgcccccgtcccgacggcatcatcgtcgagaacggcgagtactacttctcggaa
ttcccgcccggccaggcggtggcgcggctggggctgccgcaggctgacacgctgggtgag
ttcctgaacggcctgaacagcgacagcggcgaggacaaccgcatccgggtcgcgccgggc
gtgggcacgcagaacgcgcagccctggtcgcagaagatcccgttctga

DBGET integrated database retrieval system