KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_009651
Entry
NH44784_009651    CDS       T02785                                 

Definition
(GenBank) FIG00954712: hypothetical protein
Organism
axo  Achromobacter xylosoxidans NH44784-1996
SSDB
Motif
Pfam: DUF2859 DUF2384
Other DBs
NCBI-ProteinID: CCH04944
LinkDB
Position
complement(1023099..1023647)
AA seq 182 aa
MTKPHPAHLAFTGLLMLLSGLPLASRAGEPLIVVEDRGGTSALPYYEALNLQPRANAPAR
PSIPTPQVPATRADEAAMLPVRSAKLTPGTVARRVIEAPGLRPFVVIGDDEASRAWLQRR
AAALRERGAVGLVVNVETAQGLARLRALVPGVPLAPVAGDDLADRLGLRHYPALITATGI
EQ
NT seq 549 nt   +upstreamnt  +downstreamnt
atgacgaaaccccatcccgcccatctcgcgttcacgggcctactcatgctgctgtcaggc
ctgccgctggcctcgcgtgccggcgagccactgatcgttgtcgaggaccgtggcggcacg
tcggcattgccgtactacgaagccctgaatctccagccgcgcgccaacgcaccggcgcgg
ccgtccatcccgacgccccaggttcctgccacacgggcggacgaagccgcgatgctgccg
gtgcgcagcgccaagctcacgcccggcaccgtcgcgcgacgggtgatcgaagcgcccggc
ctgcggccgttcgtggtcatcggcgacgacgaggcttcccgggcctggttgcagcgccgc
gccgccgctttgcgcgaacgtggcgcggtcggcctggtcgtcaacgtcgagaccgcgcag
ggcctggcgcggctgcgcgccctggtgccgggcgtgccgctcgcgcccgtggccggcgac
gacctggccgatcgcctgggcctgcggcactacccggcgctgatcacggccaccggcatc
gagcaatga

DBGET integrated database retrieval system