KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_025011Help
Entry
NH44784_025011    CDS       T02785                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00970  Aminoacyl-tRNA biosynthesis
axo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:axo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NH44784_025011
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:axo03029]
    NH44784_025011
Enzymes [BR:axo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NH44784_025011
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NH44784_025011
Mitochondrial biogenesis [BR:axo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NH44784_025011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: CCH06466
LinkDB All DBs
Position
complement(2665226..2666683)
Genome map
AA seq 485 aa AA seqDB search
MNWEIVIGLETHTQLSTDSKIFSGSSTEFGAAPNTHANEVDLALPGSLPVMNRGAAERAI
RFGLAVGAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVVGGSLSFFVGEEEKTVNLTR
AHLEEDAGKSSHDNFALANGSPASGIDLNRAGTPLLEIVTEPEMRSAAEAVAYARALHSL
VVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAITYEARRQIE
LIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPTLVISREWVDEVRAAMP
ELPAAQRARFESEYGLPAYDAAQLTVSRDLAAYFEAVAHALPAGQAKLAANWIMGEVAAT
LNKEEKAIADAPVQAPALAALINRIIDGTISNKIAREVFGAMWAGENGGQPDAIIEARGL
KQISDSGAIGAMIDEVLAANPAIVEEYRAGKQKAFNSLVGQIMKAARGKANPQQVNDLLK
QKLDN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaaatcgtcatcggcctggaaacgcacacccagctttccaccgactccaag
atcttttcgggcagcagcaccgaattcggcgccgcgcccaacacccacgccaacgaggtc
gacctggccctgccgggcagcctgccggtcatgaaccgcggcgccgccgaacgcgccatc
cgcttcggcctggcggtcggcgccgagatcgcgccgcgctcggtgttcgcgcgcaagaac
tacttctaccccgacctgcccaagggctaccagatcagccagtacgagttgccggtggtg
gtgggcggttcgctgtcgttcttcgtcggcgaggaagaaaaaaccgtcaacctgacgcgc
gcccacctggaagaagacgcgggcaagtcctcgcacgacaatttcgccctggccaacggc
tcgccggccagcggcatcgacctgaaccgcgccggcacgccgctgctggaaatcgtcacc
gaaccggaaatgcgctcggccgccgaggccgtggcctatgcccgcgccctgcacagcctg
gtggtctggctcggcatctgcgacggcaacatgcaggaaggctcgttccgctgcgacgcc
aacgtctcggtgcgcccggtcggccagaaggaattcggcacccgcaccgagatcaagaac
gtcaactcgttccgcttcctggaacgcgccatcacctacgaagcgcggcgccagatcgag
ctgatcgaggacggcggcaccgtggtccaggaaacccgcctgtacgacgccgaccgcgac
gaaacccgcagcatgcgcagcaaggaagacgcgcacgactaccgctacttccccgatccc
gacctgcccacgctggtgatctcgcgcgagtgggtggacgaggtccgcgccgccatgccg
gagctgccggccgcccagcgcgcccgcttcgaatccgaatacggcctgccggcctacgac
gccgcgcagctgaccgtcagccgcgacctggccgcctacttcgaggccgtggcgcacgcg
ctgccggccggccaggccaagctggccgccaactggatcatgggcgaagtggccgccacc
ctgaacaaggaagaaaaggccatcgccgacgcgccggtgcaggcgccggccctggccgcg
ctgatcaaccgcatcatcgacggcaccatctccaacaagatcgcgcgtgaagtgttcggc
gccatgtgggccggcgagaacggcggccagcccgacgccatcatcgaagcccgcggcctc
aagcagatcagcgacagcggcgccatcggcgccatgatcgacgaggtgctggcggccaat
ccggccatcgtcgaggaataccgcgccggcaagcagaaggcgttcaactcgctggtcggc
cagatcatgaaggccgcgcgcggcaaggccaacccgcaacaggtcaacgacctgctcaag
cagaagctggacaactga

DBGET integrated database retrieval system