KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_026901Help
Entry
NH44784_026901    CDS       T02785                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00620  Pyruvate metabolism
axo00680  Methane metabolism
axo01100  Metabolic pathways
axo01120  Microbial metabolism in diverse environments
axo01200  Carbon metabolism
Module
axo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:axo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NH44784_026901
  09102 Energy metabolism
   00680 Methane metabolism
    NH44784_026901
Enzymes [BR:axo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NH44784_026901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: CCH06653
LinkDB All DBs
Position
complement(2852938..2855784)
Genome map
AA seq 948 aa AA seqDB search
MNASRPQSDSAEPLRHDIRLLGRLLGEVIAECEGKRVFDTIETLRRTAVKFRREGNAADG
KLLEQRVKHLQGSDPNSVARAFSYFLHLSNIAEDRDQNRSQRARALAGDAPARGSLRDAV
QTLGRQGVTPARIRRLLAEACVMPVLTAHPTEVQRKSTLDVHREIAAALTQRDQPLTPEE
LAELDAALLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQVIPRVYGDLSKLLNR
DAKPFGAPPAPLEPFLRMGSWIGGDRDGNPNVDADTLERALLRQATVLFEHYLQEVHALG
AELSITTLLIAVDPALLALAEHSGDDSPHRSDEPYRRALVGVYARLAATALRLTGQNLAR
RSTVAAQPYDTPQELSADLAIIAASLAAHHGAPIGRLRLAGLQQAVEVFGFHLATVDLRQ
SSDVHERALAELFSRAGVTHAGQPLDYLALDEDARVALLRAELAQARPLASPWIAYSEDT
TRELAVLRAAAAGRQRYGKQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPAGQDIPPED
GLMVVPLFETIPDLQRGADIMAAWLDLPEIRERVKRAQNGAQEVMLGYSDSNKDGGFLTS
NWSLYQAERALVDVFSSRHVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQIRLTEQ
GEVIQSKYKDAEVGRWHLELLVAATLESSLAPRAEATSAEDAHMAHHGPAMSFMSEAAQR
SYRGLVYDTPRFAEYFFAATPIAEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQCRL
MLTGWYGMGSAIEAYLETGAPGAPRSQRGRLAQLREMARDWPAFRTLLSNMEMVLAKSDL
AIAARYAQLVPQRALREKIFGMISAEHARTLAMLKLLTRRELLADNPALQASLRERFAYI
DPLNYLQVDLIRRHRAAQKSPAAEADERVQRAIHLTINGIAAGLRNSG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccagccgcccgcagtccgattcagcagaacccttgcgtcacgatatccggctg
ttaggccgattgctcggcgaagtcatcgccgaatgcgaaggcaaacgcgtcttcgacacc
atcgagaccctgcgccgcaccgccgtcaaattccgccgcgaaggcaatgccgccgacggc
aagctgctggaacagcgcgtcaagcacctgcagggcagcgaccccaactcggtggcgcgc
gccttcagctatttcctgcacctgtccaacatcgccgaggaccgcgaccagaaccgcagc
cagcgcgcccgcgcgctggcgggcgacgcgccggcccgcggcagcctgcgcgatgccgtg
cagaccctgggccgccagggcgtgacgcccgcgcgcatccgccgcctgctggccgaggcc
tgcgtcatgccggtgctgaccgcccaccccaccgaggtgcaacgcaagagcacgctggac
gtgcatcgcgaaatcgccgcggcattgacccagcgcgaccaacccttgactcccgaggaa
ctggccgagctcgacgccgcgctgctcggccgcgtggccacgctgtggcagacgcgcatg
ctgcgctacacccgcctgacggtggccgacgaaatcgagaacgcgctgtcgtactaccgc
agcaccttcctgcaggtcatcccgcgcgtctacggcgacctgtccaagctgctcaaccgc
gacgccaagcccttcggcgccccgcccgcgccgctggagccgttcctgcgcatgggcagc
tggatcggcggcgaccgcgacggcaaccccaacgtcgacgccgacacgctggagcgcgcc
ctgctgcgccaggccacggtgctgttcgagcactatctgcaggaagtccacgcgctgggc
gccgaactgtccatcaccacgctgctgatcgcggtcgacccggcgctgctggcgctggcc
gaacacagcggcgacgactctccgcatcgcagcgacgagccctaccgccgcgcgctggtc
ggcgtctatgcgcgcctggccgccaccgcgctgcgcctgaccggccagaacctggcccgc
cgcagcaccgtcgcggcgcaaccctacgacacgccgcaggaattgtcggccgacctggcc
atcatcgccgcgtcgctggccgcgcaccatggcgcgcccatcggccggctgcgcctggcc
ggcttgcagcaggccgtcgaagtgttcggtttccacctcgccacggtcgacctgcgccag
agttccgacgtgcacgaacgcgcgctggctgaattgttcagccgcgccggcgtcacgcac
gcgggccagccgctggactatctggcgctggacgaggacgcgcgcgtggccctgctgcgc
gccgaactggcgcaggcgcggccgctggcctcgccctggatcgcctacagcgaggacacc
acgcgcgagctcgcggtgctgcgcgccgccgccgccggccgccagcgctatggcaagcag
gccgtgcgtcagaccatcgtctcgcacaccgaaacgctcagcgacctgctggaagtgatg
gtgctgcaaaaggaagcgggcctgatcgcgcccgccggccaggacatcccgccagaagac
ggcctgatggtggtgccgctgttcgagaccatccccgacctgcagcgcggcgccgacatc
atggccgcctggctcgacctgcccgagatccgcgagcgcgtgaagcgcgcccagaacggc
gcccaggaagtcatgctgggttattccgacagcaacaaggacggcggtttcctcacctcc
aactggtcgctgtaccaggccgagcgcgcgctggtcgacgtgttctccagccgtcacgtg
cgcctgcgcctgttccacggccgcggcggctcggtgggccgcggcggcggttccagcttc
gacgccatcctggcgcagccgcccggcaccgtggccggccagatccgcctgaccgaacag
ggcgaagtcatccagagcaagtacaaggacgccgaggtcggccgctggcacctggagctg
ctggtcgccgccacgctcgaatccagcctggcgccgcgcgccgaggccaccagcgccgaa
gacgcgcacatggcccaccatggccccgccatgtcgttcatgtccgaggccgcgcagcgc
agctaccgcggcctggtgtatgacacgccgcgctttgccgaatacttcttcgccgccacc
cccatcgccgagatcgccggcctgaacatcggctcgcgcccggcctcacgcaagaagggc
cagcgcatcgaagacctgcgcgccatcccctgggggttttcctgggcccaatgccgcctg
atgctgaccggctggtacggcatgggctcggccatcgaggcctacctggagaccggcgcg
ccgggggcgccgcgctcgcagcgcggccgcctggcccagttgcgcgaaatggcgcgcgac
tggcccgccttccgcaccctgctgtccaacatggagatggtgctggccaagtccgacctg
gccatcgccgcgcgctatgcgcagttggtgccgcagcgcgcgctgcgcgagaagatcttc
ggcatgatcagcgccgaacacgcccgcaccctggccatgctcaagctgctgacgcggcgc
gagctgctggccgacaaccccgcgctgcaggcctcgctgcgcgagcgcttcgcctacata
gacccgctcaactacctgcaggtcgacctgatccgccgccaccgcgcggcgcagaagtcg
cccgccgccgaggccgacgaacgcgtgcaacgcgccatccacctgaccatcaacggcatc
gccgccgggttgcgcaattcgggctga

DBGET integrated database retrieval system