KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_031351Help
Entry
NH44784_031351    CDS       T02785                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo03030  DNA replication
axo03410  Base excision repair
axo03420  Nucleotide excision repair
axo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:axo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    NH44784_031351
   03410 Base excision repair
    NH44784_031351
   03420 Nucleotide excision repair
    NH44784_031351
   03430 Mismatch repair
    NH44784_031351
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:axo03032]
    NH44784_031351
   03400 DNA repair and recombination proteins [BR:axo03400]
    NH44784_031351
Enzymes [BR:axo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NH44784_031351
    6.5.1.6  DNA ligase (ATP or NAD+)
     NH44784_031351
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     NH44784_031351
DNA replication proteins [BR:axo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    NH44784_031351
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     NH44784_031351
DNA repair and recombination proteins [BR:axo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     NH44784_031351
   NER (nucleotide excision repair)
    Other NER factors
     NH44784_031351
   MMR (mismatch exicision repair)
    Other MMR factors
     NH44784_031351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: CCH07095
LinkDB All DBs
Position
3366586..3368190
Genome map
AA seq 534 aa AA seqDB search
MKRFAALYQELDRSTATLDKRAALVAYFRDAPPRDAAWALYLLAGGKITSARRKIAAVGE
LRAWVASASDTAPWLVDACYDQVGDLAETLALLVPDPATAAPERGLADWIEEILLPVANR
DEGERREVIVAAWMGLPYAERLVFNKLLTGALRVGVSQRMVQQALAEMSGVAIARIAQRM
LGAWSPSPAFLRDLLSAEELPGDRQQPYPFFLASPLEGDPALLGPIGDWLLEWKWDGIRA
QLIRRRGEVALWSRGEERLDGRFPEVEAAAAALDVDCVMDGELLAWQDDTAGPMPFSALQ
TRIQRLKPGPKWLAETPVRLLAYDLLELDGADLRELPQTERRARLEALLRRHSDPRLRLS
PIVAPESWDEARLLRAQSHERGVEGFMLKRGAAPYQSGRRRGDWWKWKIDPLTIDAVLLY
AQSGHGRRSTLYTDYTFGLWDGDALVPIAKAYSGLDDKEILELDRWLRAHTRERFGPVRS
VDPVQVFELGFEGVNLSKRHKSGVAVRFPRILRWRHDKRADQADRLDTLKALAR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattcgcggcgttgtatcaggaactggaccgcagtaccgccaccttggacaag
cgcgcggcgctggtggcgtacttccgtgatgcgccgccccgcgacgcggcatgggcgttg
tatctgctggccggcggcaagatcaccagcgcgcgcaggaagatcgcggcggtcggcgaa
ctgcgcgcctgggtcgcgagcgcgtccgacaccgcgccctggctggtggatgcctgctat
gaccaggtcggcgacctggccgagacgctggcgctgctggttcccgaccccgccaccgcc
gcgcccgagcgcggcctggccgattggatcgaagagatcctgttgcccgtggccaatcgc
gacgagggcgagcgccgcgaggtcatcgtggccgcatggatgggcctgccgtatgcggaa
cgcctggtcttcaacaaactgctgaccggcgccctgcgcgtcggcgtgtcgcagcggatg
gtgcagcaggcgctggcggagatgtcgggcgtggccatcgcgcgcatcgcgcagcgcatg
ctgggcgcgtggtcgcccagccccgccttcctgcgtgacttgctgagcgccgaggaattg
cccggcgaccgccagcagccttaccccttctttctggcttcgccgttggagggcgatccg
gcgctgctggggccgatcggcgactggctgctcgaatggaagtgggacggcatccgcgcg
caattgatacggcggcgcggcgaagtggcattgtggtcgcgcggcgaggagcgcctggac
ggccggtttcccgaggtcgaggccgcggccgcggcgctggatgtggactgcgtcatggac
ggggaactgctggcctggcaggacgacacagccggtcccatgccgttttccgccttgcag
acccgcatccagcgtctcaagcccgggcccaagtggctggccgagacgccggtgcgcctg
ctggcctacgatttgctggagctggacggcgccgacctgcgcgagctgccgcagaccgaa
cggcgcgcccggctggaagcgttgctgcgccggcattcggacccgcgcctgcggctgtcg
ccgatcgtcgcgcccgaaagctgggacgaggcccgcctgctgcgcgcgcaatcgcacgaa
cgcggcgtcgagggcttcatgctcaagcgcggcgccgcgccgtaccagagcggcaggcgg
cgcggcgactggtggaagtggaagatcgatccgctcaccatcgacgcggtgctgctgtat
gcgcagtccggccacggccgccgcagcacgctctacaccgactacaccttcggcctgtgg
gatggcgatgcgctggtgcccatcgccaaggcctattcgggcctggacgacaaggagatc
ctggaactggaccgttggctgcgcgcccacacgcgcgagcgtttcggcccggtgcgctcg
gttgatccggtacaggtgttcgagctgggtttcgagggcgtcaacctgtccaagcgccac
aagtcgggcgtggcggtgcgttttccgcgcatcctgcgctggcggcatgacaagcgcgcc
gaccaggccgaccggctcgacacgttgaaggcgctggcgcgatga

DBGET integrated database retrieval system