KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_034441Help
Entry
NH44784_034441    CDS       T02785                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00061  Fatty acid biosynthesis
axo00780  Biotin metabolism
axo01100  Metabolic pathways
axo01130  Biosynthesis of antibiotics
axo01212  Fatty acid metabolism
Module
axo_M00083  Fatty acid biosynthesis, elongation
axo_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:axo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NH44784_034441
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NH44784_034441
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NH44784_034441
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:axo01004]
    NH44784_034441
Enzymes [BR:axo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NH44784_034441
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NH44784_034441
Lipid biosynthesis proteins [BR:axo01004]
 Fatty acid synthase
  Component type
   NH44784_034441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: CCH07398
LinkDB All DBs
Position
complement(3677723..3678496)
Genome map
AA seq 257 aa AA seqDB search
MSAALPLAGKRGLVTGIANADSIAWGCAKAFRAMGAELAVTYLNDKARPHVEPLARQVDA
PLLMPLDLLREGELEAVFERITAEWGGLDFVLHSIAYAPRDDLHGRVTDCSRAGFLTAMD
VSCWSFIRMAKLAEPLMPAGGTLFCMSYYGSQMVVEHYNMMGPVKAALESATRYLAAELG
PQGIRVHAISPGPLKTRAASGIAEFDALLDRAQAKAPARSLVSIDDVGEATAWLATDAAR
RMTGQTLYIDGGYHIID
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgccctgcctcttgccggcaagcgcggcctggtcaccggcatcgccaacgcc
gactccatcgcctggggctgcgccaaggcgttccgcgccatgggcgcggaactggccgtg
acctacctgaacgacaaggcccgcccgcacgtcgagccgctggcgcgccaggtcgacgcg
ccgctgctgatgccgctggacctgctgcgcgagggcgagctggaggcggtgttcgagcgc
atcaccgccgaatggggcggcctggacttcgtgctgcattccatcgcctacgccccgcgc
gacgacctgcacggccgcgtcacggactgctcgcgcgccggcttcctgacggccatggac
gtgtcatgctggtcattcatccgcatggccaagctggccgaaccgctgatgccggccggc
ggcaccttgttctgcatgagctactacggctcgcagatggtggtcgagcactacaacatg
atgggcccggtgaaggccgcgctggaatcggccacccgctacctggcagccgagctcggc
ccgcagggcatccgcgtgcatgcgatctcccccggaccgctcaagacccgcgccgcctcg
ggcattgccgagttcgacgcgctgctcgaccgcgcccaggccaaggcgccggcgcgcagc
ctggtgtcgatcgacgacgtcggcgaggccaccgcctggctcgccaccgacgccgcccgc
cgcatgaccgggcagacgctgtatatcgacggcggctatcacatcatcgattga

DBGET integrated database retrieval system