KEGG   Achromobacter xylosoxidans NH44784-1996: NH44784_034551Help
Entry
NH44784_034551    CDS       T02785                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
axo  Achromobacter xylosoxidans NH44784-1996
Pathway
axo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:axo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NH44784_034551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:axo02000]
    NH44784_034551
Enzymes [BR:axo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NH44784_034551
Transporters [BR:axo02000]
 Other Transporters
  Pores ion channels [TC:1]
   NH44784_034551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: CCH07409
LinkDB All DBs
Position
3687488..3688102
Genome map
AA seq 204 aa AA seqDB search
MLTLYHAPRSRSFRILWLLEELGVPYDTEMVSIRRRDGSGHIPPDYIDIHPHGKVPALVH
DGVPVFETPAIALYLTDLFPQAGLGPVIGDPQRGPYLTWLAYSTGVFEPAMTERVFKTAH
QQGTMGWGSADEVEQVVTRVLQARPYFLGEHFSAVDIVLGGTLQFMMQMKVIAENPVFSA
YAERLAARPAMHRALQRDGDIGEG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccctctatcacgccccgcgctcgcgctctttccgcattctctggctgctcgaa
gagctgggcgtgccctacgacaccgagatggtgtcgatccgccgccgtgacggctccggc
catatcccgcccgactacatcgacatccacccgcacggcaaggtgccggcgctggtgcac
gacggggtgccggtgttcgaaacccccgccatcgcgctttacctgaccgacctgttcccc
caggccggcctgggtccggtcatcggcgatccgcaacgcggtccctacctgacctggctg
gcctactcgaccggcgtgttcgagcccgccatgaccgagcgcgtgttcaagacggcgcac
cagcagggcacgatggggtggggctcggccgacgaggtcgaacaggtcgtgacccgggtg
ctgcaggcccgcccgtatttcctcggcgagcatttcagcgccgtcgacatcgtgctgggc
ggcaccttgcagttcatgatgcagatgaaggtgattgccgagaacccggtgttctcggcc
tatgccgagcggctggcggcgcgtccggcgatgcaccgcgccttgcagcgcgacggtgac
atcggcgaaggctga

DBGET integrated database retrieval system